ITM2B (NM_021999) Human Tagged ORF Clone

SKU
RC202377
ITM2B (Myc-DDK-tagged)-Human integral membrane protein 2B (ITM2B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ITM2B
Synonyms ABRI; BRI; BRI2; BRICD2B; E3-16; E25B; FBD; imBRI2; RDGCA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202377 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGAAGGTGACGTTCAACTCCGCTCTGGCCCAGAAGGAGACCAAGAAGGACGAGCCCAAGAGCGGCG
AGGAGGCGCTCATCATCCCCCCCGACGCCGTCGCGGTGGACTGCAAGGACCCAGATGATGTGGTACCAGT
TGGCCAAAGAAGAGCCTGGTGTTGGTGCATGTGCTTTGGACTAGCATTTATGCTTGCAGGTGTTATTCTA
GGAGGAGCATACTTGTACAAATATTTTGCACTTCAACCAGATGACGTGTACTACTGTGGAATAAAGTACA
TCAAAGATGATGTCATCTTAAATGAGCCCTCTGCAGATGCCCCAGCTGCTCTCTACCAGACAATTGAAGA
AAATATTAAAATCTTTGAAGAAGAAGAAGTTGAATTTATCAGTGTGCCTGTCCCAGAGTTTGCAGATAGT
GATCCTGCCAACATTGTTCATGACTTTAACAAGAAACTTACAGCCTATTTAGATCTTAACCTGGATAAGT
GCTATGTGATCCCTCTGAACACTTCCATTGTTATGCCACCCAGAAACCTACTGGAGTTACTTATTAACAT
CAAGGCTGGAACCTATTTGCCTCAGTCCTATCTGATTCATGAGCACATGGTTATTACTGATCGCATTGAA
AACATTGATCACCTGGGTTTCTTTATTTATCGACTGTGTCATGACAAGGAAACTTACAAACTGCAACGCA
GAGAAACTATTAAAGGTATTCAGAAACGTGAAGCCAGCAATTGTTTCGCAATTCGGCATTTTGAAAACAA
ATTTGCCGTGGAAACTTTAATTTGTTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202377 protein sequence
Red=Cloning site Green=Tags(s)

MVKVTFNSALAQKETKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVIL
GGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADS
DPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIE
NIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021999
ORF Size 798 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021999.5
RefSeq Size 1896 bp
RefSeq ORF 801 bp
Locus ID 9445
UniProt ID Q9Y287
Cytogenetics 13q14.2
Domains BRICHOS
Protein Families Druggable Genome, Transmembrane
MW 30.4 kDa
Summary Amyloid precursor proteins are processed by beta-secretase and gamma-secretase to produce beta-amyloid peptides which form the characteristic plaques of Alzheimer disease. This gene encodes a transmembrane protein which is processed at the C-terminus by furin or furin-like proteases to produce a small secreted peptide which inhibits the deposition of beta-amyloid. Mutations which result in extension of the C-terminal end of the encoded protein, thereby increasing the size of the secreted peptide, are associated with two neurogenerative diseases, familial British dementia and familial Danish dementia. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:ITM2B (NM_021999) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202377L1 Lenti ORF clone of Human integral membrane protein 2B (ITM2B), Myc-DDK-tagged 10 ug
$600.00
RC202377L2 Lenti ORF clone of Human integral membrane protein 2B (ITM2B), mGFP tagged 10 ug
$600.00
RC202377L3 Lenti ORF clone of Human integral membrane protein 2B (ITM2B), Myc-DDK-tagged 10 ug
$600.00
RC202377L4 Lenti ORF clone of Human integral membrane protein 2B (ITM2B), mGFP tagged 10 ug
$600.00
RG202377 ITM2B (tGFP-tagged) - Human integral membrane protein 2B (ITM2B) 10 ug
$500.00
SC108808 ITM2B (untagged)-Human integral membrane protein 2B (ITM2B) 10 ug
$300.00
SC322363 ITM2B (untagged)-Human integral membrane protein 2B (ITM2B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.