OIP5 (NM_007280) Human Tagged ORF Clone

SKU
RC202255
OIP5 (Myc-DDK-tagged)-Human Opa interacting protein 5 (OIP5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol OIP5
Synonyms 5730547N13Rik; CT86; hMIS18beta; LINT-25; MIS18B; MIS18beta
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202255 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTCAGCCGCTGCGGCATCGCTCACGTTGTGCAACGCCGCCCCGGGGGGACTTTTGTGGTGGCA
CTGAGAGGGCGATTGACCAAGCTTCTTTTACGACCTCCATGGAGTGGGATACGCAGGTGGTGAAGGGGTC
CTCGCCGCTCGGCCCCGCAGGGCTGGGGGCTGAGGAGCCAGCCGCCGGCCCGCAGCTGCCGTCTTGGCTG
CAGCCTGAGAGGTGCGCTGTGTTCCAGTGCGCACAGTGTCACGCAGTGCTCGCCGACTCGGTGCACCTCG
CCTGGGACCTGTCGCGGTCCCTCGGGGCCGTGGTCTTCTCCAGAGTTACAAATAACGTCGTTTTGGAAGC
GCCCTTCCTAGTTGGCATTGAAGGTTCACTCAAAGGCAGTACTTACAACCTTTTATTCTGTGGTTCTTGT
GGGATTCCCGTTGGTTTCCATCTGTATTCTACCCATGCTGCCCTGGCTGCCTTGAGAGGTCACTTCTGCC
TTTCCAGTGACAAAATGGTGTGCTATCTCTTAAAAACAAAAGCCATAGTAAATGCATCAGAGATGGATAT
TCAAAATGTTCCTCTATCAGAAAAGATTGCAGAGCTGAAAGAGAAGATAGTGCTAACGCACAATCGCTTA
AAATCACTAATGAAGATTCTGAGTGAAGTGACTCCTGACCAGTCCAAGCCAGAAAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202255 protein sequence
Red=Cloning site Green=Tags(s)

MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWL
QPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSC
GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRL
KSLMKILSEVTPDQSKPEN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007280
ORF Size 687 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007280.2
RefSeq Size 1249 bp
RefSeq ORF 690 bp
Locus ID 11339
UniProt ID O43482
Cytogenetics 15q15.1
MW 24.7 kDa
Summary The protein encoded by this gene localizes to centromeres, where it is essential for recruitment of CENP-A through the mediator Holliday junction recognition protein. Expression of this gene is upregulated in several cancers, making it a putative therapeutic target. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:OIP5 (NM_007280) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202255L1 Lenti ORF clone of Human Opa interacting protein 5 (OIP5), Myc-DDK-tagged 10 ug
$600.00
RC202255L2 Lenti ORF clone of Human Opa interacting protein 5 (OIP5), mGFP tagged 10 ug
$600.00
RC202255L3 Lenti ORF clone of Human Opa interacting protein 5 (OIP5), Myc-DDK-tagged 10 ug
$600.00
RC202255L4 Lenti ORF clone of Human Opa interacting protein 5 (OIP5), mGFP tagged 10 ug
$600.00
RG202255 OIP5 (tGFP-tagged) - Human Opa interacting protein 5 (OIP5) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC122777 OIP5 (untagged)-Human Opa interacting protein 5 (OIP5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.