Tsukushin (TSKU) (NM_015516) Human Tagged ORF Clone

SKU
RC202232
TSKU (Myc-DDK-tagged)-Human tsukushi small leucine rich proteoglycan homolog (Xenopus laevis) (TSKU)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Tsukushin
Synonyms E2IG4; LRRC54; TSK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202232 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGTGGCCCCTGCTGCTGCTGCTGGCCGTGAGTGGGGCCCAGACAACCCGGCCATGCTTCCCCGGGT
GCCAATGCGAGGTGGAGACCTTCGGCCTTTTCGACAGCTTCAGCCTGACTCGGGTGGATTGTAGCGGCCT
GGGCCCCCACATCATGCCGGTGCCCATCCCTCTGGACACAGCCCACTTGGACCTGTCCTCCAACCGGCTG
GAGATGGTGAATGAGTCGGTGTTGGCGGGGCCGGGCTACACGACGTTGGCTGGCCTGGATCTCAGCCACA
ACCTGCTCACCAGCATCTCACCCACTGCCTTCTCCCGCCTTCGCTACCTGGAGTCGCTTGACCTCAGCCA
CAATGGCCTGACAGCCCTGCCAGCCGAGAGCTTCACCAGCTCACCCCTGAGCGACGTGAACCTTAGCCAC
AACCAGCTCCGGGAGGTCTCAGTGTCTGCCTTCACGACGCACAGTCAGGGCCGGGCACTACACGTGGACC
TCTCCCACAACCTCATTCACCGCCTCGTGCCCCACCCCACGAGGGCCGGCCTGCCTGCGCCCACCATTCA
GAGCCTGAACCTGGCCTGGAACCGGCTCCATGCCGTGCCCAACCTCCGAGACTTGCCCCTGCGCTACCTG
AGCCTGGATGGGAACCCTCTAGCTGTCATTGGTCCGGGTGCCTTCGCGGGGCTGGGAGGCCTTACACACC
TGTCTCTGGCCAGCCTGCAGAGGCTCCCTGAGCTGGCGCCCAGTGGCTTCCGTGAGCTACCGGGCCTGCA
GGTCCTGGACCTGTCGGGCAACCCCAAGCTTAACTGGGCAGGAGCTGAGGTGTTTTCAGGCCTGAGCTCC
CTGCAGGAGCTGGACCTTTCGGGCACCAACCTGGTGCCCCTGCCTGAGGCGCTGCTCCTCCACCTCCCGG
CACTGCAGAGCGTCAGCGTGGGCCAGGATGTGCGGTGCCGGCGCCTGGTGCGGGAGGGCACCTACCCCCG
GAGGCCTGGCTCCAGCCCCAAGGTGGCCCTGCACTGCGTAGACACCCGGGATTCTGCTGCCAGGGGCCCC
ACCATCTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202232 protein sequence
Red=Cloning site Green=Tags(s)

MPWPLLLLLAVSGAQTTRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDTAHLDLSSNRL
EMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSH
NQLREVSVSAFTTHSQGRALHVDLSHNLIHRLVPHPTRAGLPAPTIQSLNLAWNRLHAVPNLRDLPLRYL
SLDGNPLAVIGPGAFAGLGGLTHLSLASLQRLPELAPSGFRELPGLQVLDLSGNPKLNWAGAEVFSGLSS
LQELDLSGTNLVPLPEALLLHLPALQSVSVGQDVRCRRLVREGTYPRRPGSSPKVALHCVDTRDSAARGP
TIL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015516
ORF Size 1059 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015516.4
RefSeq Size 2725 bp
RefSeq ORF 1062 bp
Locus ID 25987
UniProt ID Q8WUA8
Cytogenetics 11q13.5
Domains LRR
Protein Families Secreted Protein
MW 37.8 kDa
Summary Contributes to various developmental events and other processes such as wound healing and cholesterol homeostasis through its interactions with multiple signaling pathways. Wnt signaling inhibitor which competes with WNT2B for binding to Wnt receptor FZD4 and represses WNT2B-dependent development of the peripheral eye. Plays a role in regulating the hair cycle by controlling TGFB1 signaling. Required for the development of the anterior commissure in the brain by inhibiting neurite outgrowth. Essential for terminal differentiation of hippocampal neural stem cells. Plays a role in regulating bone elongation and bone mass by modulating growth plate chondrocyte function and overall body size. Required for development of the inner ear through its involvement in stereocilia formation in inner hair cells. Facilitates wound healing by inhibiting secretion of TGFB1 from macrophages which prevents myofibroblast differentiation, maintaining inflammatory cell quiescence. Plays a role in cholesterol homeostasis by reducing circulating high-density lipoprotein cholesterol, lowering cholesterol efflux capacity and decreasing cholesterol-to-bile acid conversion in the liver. In one study, shown to negatively regulate sympathetic innervation in brown fat, leading to reduced energy expenditure. In another study, shown not to affect brown fat thermogenic capacity, body weight gain or glucose homeostasis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Tsukushin (TSKU) (NM_015516) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202232L3 Lenti ORF clone of Human tsukushi small leucine rich proteoglycan homolog (Xenopus laevis) (TSKU), Myc-DDK-tagged 10 ug
$757.00
RC202232L4 Lenti ORF clone of Human tsukushi small leucine rich proteoglycan homolog (Xenopus laevis) (TSKU), mGFP tagged 10 ug
$757.00
RG202232 TSKU (tGFP-tagged) - Human tsukushi small leucine rich proteoglycan homolog (Xenopus laevis) (TSKU) 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC114661 TSKU (untagged)-Human tsukushi small leucine rich proteoglycan homolog (Xenopus laevis) (TSKU) 10 ug
$457.00
SC323739 TSKU (untagged)-Human tsukushi small leucine rich proteoglycan homolog (Xenopus laevis) (TSKU) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.