GSTA4 (NM_001512) Human Tagged ORF Clone

SKU
RC202130
GSTA4 (Myc-DDK-tagged)-Human glutathione S-transferase alpha 4 (GSTA4)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GSTA4
Synonyms GSTA4-4; GTA4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202130 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCAAGGCCCAAGCTCCACTATCCCAACGGAAGAGGCCGGATGGAGTCCGTGAGATGGGTTTTAG
CTGCCGCCGGAGTCGAGTTTGATGAAGAATTTCTGGAAACAAAAGAACAGTTGTACAAGTTGCAGGATGG
TAACCACCTGCTGTTCCAACAAGTGCCCATGGTTGAAATTGACGGGATGAAGTTGGTACAGACCCGAAGC
ATTCTCCACTACATAGCAGACAAGCACAATCTCTTTGGCAAGAACCTCAAGGAGAGAACCCTGATTGACA
TGTACGTGGAGGGGACACTGGATCTGCTGGAACTGCTTATCATGCATCCTTTCTTAAAACCAGATGATCA
GCAAAAGGAAGTGGTTAACATGGCCCAGAAGGCTATAATTAGATACTTTCCTGTGTTTGAAAAGATTTTA
AGGGGTCACGGACAAAGCTTTCTTGTTGGTAATCAGCTGAGCCTTGCAGATGTGATTTTACTCCAAACCA
TTTTAGCTCTAGAAGAGAAAATTCCTAATATCCTGTCTGCATTTCCTTTCCTCCAGGAATACACAGTGAA
ACTAAGTAATATCCCTACAATTAAGAGATTCCTTGAACCTGGCAGCAAGAAGAAGCCTCCCCCTGATGAA
ATTTATGTGAGAACCGTCTACAACATCTTTAGGCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202130 protein sequence
Red=Cloning site Green=Tags(s)

MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRS
ILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKIL
RGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDE
IYVRTVYNIFRP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001512
ORF Size 666 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001512.4
RefSeq Size 1352 bp
RefSeq ORF 669 bp
Locus ID 2941
UniProt ID O15217
Cytogenetics 6p12.2
Domains GST_C, GST_N
Protein Pathways Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450
MW 25.7 kDa
Summary Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GSTA4 (NM_001512) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202130L1 Lenti ORF clone of Human glutathione S-transferase alpha 4 (GSTA4), Myc-DDK-tagged 10 ug
$600.00
RC202130L2 Lenti ORF clone of Human glutathione S-transferase alpha 4 (GSTA4), mGFP tagged 10 ug
$600.00
RC202130L3 Lenti ORF clone of Human glutathione S-transferase alpha 4 (GSTA4), Myc-DDK-tagged 10 ug
$600.00
RC202130L4 Lenti ORF clone of Human glutathione S-transferase alpha 4 (GSTA4), mGFP tagged 10 ug
$600.00
RG202130 GSTA4 (tGFP-tagged) - Human glutathione S-transferase alpha 4 (GSTA4) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC119179 GSTA4 (untagged)-Human glutathione S-transferase alpha 4 (GSTA4) 10 ug
$300.00
SC322435 GSTA4 (untagged)-Human glutathione S-transferase alpha 4 (GSTA4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.