Oligodendrocyte Specific Protein (CLDN11) (NM_005602) Human Tagged ORF Clone
SKU
RC202087
CLDN11 (Myc-DDK-tagged)-Human claudin 11 (CLDN11), transcript variant 1
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | Oligodendrocyte Specific Protein |
Synonyms | HLD22; OSP; OTM |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC202087 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGGCCACGTGCCTGCAGGTGGTGGGCTTCGTCACGAGCTTCGTGGGCTGGATCGGGGTCATCGTGA CCACCTCCACCAATGACTGGGTGGTGACCTGCGGCTACACCATCCCCACCTGCCGCAAGCTGGATGAGCT GGGCTCCAAGGGGCTGTGGGCCGACTGCGTCATGGCCACGGGGCTGTACCACTGCAAGCCCCTGGTGGAC ATCCTCATCCTGCCGGGCTACGTGCAGGCCTGCCGCGCCCTGATGATTGCTGCCTCGGTCCTGGGTCTGC CGGCCATTTTACTGCTGCTGACTGTTCTTCCCTGCATCCGGATGGGCCAGGAGCCCGGTGTGGCTAAGTA CAGGCGGGCCCAGCTGGCTGGTGTTTTGCTCATTCTGCTGGCTCTCTGCGCCCTTGTTGCCACCATCTGG TTCCCTGTGTGCGCCCACCGTGAGACCACCATCGTGAGCTTTGGCTACTCCCTGTATGCAGGCTGGATTG GTGCTGTGCTGTGCCTCGTGGGTGGCTGTGTCATCCTCTGCTGCGCTGGAGATGCCCAGGCCTTTGGTGA AAACCGTTTCTACTACACTGCGGGCTCTAGCTCCCCGACTCATGCGAAGAGTGCCCACGTA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202087 protein sequence
Red=Cloning site Green=Tags(s) MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVD ILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIW FPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005602 |
ORF Size | 621 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_005602.6 |
RefSeq Size | 2761 bp |
RefSeq ORF | 624 bp |
Locus ID | 5010 |
UniProt ID | O75508 |
Cytogenetics | 3q26.2 |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction |
MW | 22 kDa |
Summary | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is a major component of central nervous system (CNS) myelin and plays an important role in regulating proliferation and migration of oligodendrocytes. Mouse studies showed that the gene deficiency results in deafness and loss of the Sertoli cell epithelial phenotype in the testis. This protein is a tight junction protein at the human blood-testis barrier (BTB), and the BTB disruption is related to a dysfunction of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Aug 2010] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC202087L1 | Lenti ORF clone of Human claudin 11 (CLDN11), transcript variant 1, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC202087L2 | Lenti ORF clone of Human claudin 11 (CLDN11), transcript variant 1, mGFP tagged | 10 ug |
$600.00
|
|
RC202087L3 | Lenti ORF clone of Human claudin 11 (CLDN11), transcript variant 1, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC202087L4 | Lenti ORF clone of Human claudin 11 (CLDN11), transcript variant 1, mGFP tagged | 10 ug |
$600.00
|
|
RG202087 | CLDN11 (tGFP-tagged) - Human claudin 11 (CLDN11), transcript variant 1 | 10 ug |
$489.00
MSRP
$500.00
MSRP
$500.00
|
|
SC122723 | CLDN11 (untagged)-Human claudin 11 (CLDN11), transcript variant 1 | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.