D Box Binding Protein (DBP) (NM_001352) Human Tagged ORF Clone

SKU
RC202051
DBP (Myc-DDK-tagged)-Human D site of albumin promoter (albumin D-box) binding protein (DBP)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol D Box Binding Protein
Synonyms DABP; taxREB302
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202051 representing NM_001352
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCGGCCTGTGAGCGACAGGACCCCGGCCCCTCTGCTGCTGGGCGGCCCGGCCGGGACACCCCCTG
GCGGGGGAGCGCTGCTTGGGTTGCGGAGCCTTCTGCAGGGGACCAGCAAGCCCAAAGAGCCGGCCAGCTG
TCTCCTGAAGGAAAAGGAGCGCAAGGCGGCCCTGCCTGCAGCCACAACCCCTGGGCCAGGCCTGGAGACT
GCGGGCCCGGCGGATGCCCCGGCTGGGGCAGTGGTGGGCGGAGGGTCCCCGCGGGGGCGCCCGGGGCCGG
TGCCCGCCCCGGGTCTGTTGGCGCCACTGCTGTGGGAGCGCACGCTGCCGTTCGGCGATGTGGAGTACGT
AGACCTGGACGCCTTCCTGCTGGAGCACGGGCTCCCGCCCAGCCCGCCGCCCCCCGGTGGCCCGTCGCCG
GAGCCGTCGCCCGCGCGGACGCCCGCACCCTCCCCAGGGCCGGGTTCGTGCGGCTCGGCTTCCCCCCGCT
CCTCTCCTGGGCACGCCCCCGCCCGGGCTGCCCTCGGGACCGCCAGCGGCCACCGCGCAGGCCTGACCTC
TCGGGACACACCCAGCCCTGTGGACCCAGACACCGTGGAGGTGTTGATGACCTTTGAACCCGACCCAGCT
GATCTTGCCCTATCAAGCATTCCTGGCCACGAGACCTTTGACCCTCGAAGACATCGCTTCTCAGAAGAGG
AACTTAAGCCCCAGCCAATCATGAAGAAGGCAAGAAAAATCCAGGTGCCGGAGGAGCAGAAGGATGAGAA
ATACTGGAGCCGGCGGTACAAGAACAACGAGGCAGCCAAGCGGTCCCGTGACGCCCGGCGGCTCAAGGAG
AACCAGATATCGGTGCGGGCGGCCTTCCTGGAGAAGGAGAACGCCCTGCTGCGGCAGGAAGTTGTGGCCG
TGCGCCAGGAGCTGTCCCACTACCGCGCCGTGCTGTCCCGATACCAGGCCCAGCACGGGGCCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202051 representing NM_001352
Red=Cloning site Green=Tags(s)

MARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASCLLKEKERKAALPAATTPGPGLET
AGPADAPAGAVVGGGSPRGRPGPVPAPGLLAPLLWERTLPFGDVEYVDLDAFLLEHGLPPSPPPPGGPSP
EPSPARTPAPSPGPGSCGSASPRSSPGHAPARAALGTASGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPA
DLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKE
NQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001352
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001352.5
RefSeq Size 1478 bp
RefSeq ORF 978 bp
Locus ID 1628
UniProt ID Q10586
Cytogenetics 19q13.33
Domains BRLZ
Protein Families Transcription Factors
MW 34.2 kDa
Summary The protein encoded by this gene is a member of the PAR bZIP transcription factor family and binds to specific sequences in the promoters of several genes, such as albumin, CYP2A4, and CYP2A5. The encoded protein can bind DNA as a homo- or heterodimer and is involved in the regulation of some circadian rhythm genes. [provided by RefSeq, Jul 2014]
Write Your Own Review
You're reviewing:D Box Binding Protein (DBP) (NM_001352) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202051L1 Lenti ORF clone of Human D site of albumin promoter (albumin D-box) binding protein (DBP), Myc-DDK-tagged 10 ug
$600.00
RC202051L2 Lenti ORF clone of Human D site of albumin promoter (albumin D-box) binding protein (DBP), mGFP tagged 10 ug
$600.00
RC202051L3 Lenti ORF clone of Human D site of albumin promoter (albumin D-box) binding protein (DBP), Myc-DDK-tagged 10 ug
$600.00
RC202051L4 Lenti ORF clone of Human D site of albumin promoter (albumin D-box) binding protein (DBP), mGFP tagged 10 ug
$600.00
RG202051 DBP (tGFP-tagged) - Human D site of albumin promoter (albumin D-box) binding protein (DBP) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC119274 DBP (untagged)-Human D site of albumin promoter (albumin D-box) binding protein (DBP) 10 ug
$300.00
SC323750 DBP (untagged)-Human D site of albumin promoter (albumin D-box) binding protein (DBP) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.