EDF1 (NM_003792) Human Tagged ORF Clone

SKU
RC201996
EDF1 (Myc-DDK-tagged)-Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EDF1
Synonyms CFAP280; EDF-1; MBF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201996 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAGAGCGACTGGGACACGGTGACGGTGCTGCGCAAGAAGGGCCCTACGGCCGCCCAGGCCAAAT
CCAAGCAGGCTATCTTAGCGGCACAGAGACGAGGAGAAGATGTGGAGACTTCCAAGAAATGGGCTGCTGG
CCAGAACAAACAACATTCTATTACCAAGAACACGGCCAAGCTGGACCGGGAGACAGAGGAGCTGCACCAT
GACAGGGTGACCCTGGAGGTGGGCAAGGTGATCCAGCAAGGTCGGCAGAGCAAGGGGCTTACGCAGAAGG
ACCTGGCCACGAAAATCAATGAGAAGCCACAGGTGATCGCGGACTATGAGAGCGGACGGGCCATACCCAA
TAACCAGGTGCTTGGCAAAATCGAGCGGGCCATTGGCCTCAAGCTCCGGGGAAAGGACATTGGAAAGCCC
ATCGAGAAGGGGCCTAGGGCGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201996 protein sequence
Red=Cloning site Green=Tags(s)

MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH
DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKP
IEKGPRAK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003792
ORF Size 444 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003792.4
RefSeq Size 701 bp
RefSeq ORF 447 bp
Locus ID 8721
UniProt ID O60869
Cytogenetics 9q34.3
Domains HTH_3
Protein Families Druggable Genome, Transcription Factors
MW 16.4 kDa
Summary This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:EDF1 (NM_003792) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201996L1 Lenti ORF clone of Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, Myc-DDK-tagged 10 ug
$450.00
RC201996L2 Lenti ORF clone of Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, mGFP tagged 10 ug
$450.00
RC201996L3 Lenti ORF clone of Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, Myc-DDK-tagged 10 ug
$450.00
RC201996L4 Lenti ORF clone of Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, mGFP tagged 10 ug
$450.00
RG201996 EDF1 (tGFP-tagged) - Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha 10 ug
$489.00
SC117765 EDF1 (untagged)-Human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.