SLC31A1 (NM_001859) Human Tagged ORF Clone

SKU
RC201980
SLC31A1 (Myc-DDK-tagged)-Human solute carrier family 31 (copper transporters), member 1 (SLC31A1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SLC31A1
Synonyms COPT1; CTR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201980 representing NM_001859
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCATTCCCACCATATGGGGATGAGCTATATGGACTCCAACAGTACCATGCAACCTTCTCACCATC
ACCCAACCACTTCAGCCTCACACTCCCATGGTGGAGGAGACAGCAGCATGATGATGATGCCTATGACCTT
CTACTTTGGCTTTAAGAATGTGGAACTACTGTTTTCCGGTTTGGTGATCAATACAGCTGGAGAAATGGCT
GGAGCTTTTGTGGCAGTGTTTTTACTAGCAATGTTCTATGAAGGACTCAAGATAGCCCGAGAGAGCCTGC
TGCGTAAGTCACAAGTCAGCATTCGCTACAATTCCATGCCTGTCCCAGGACCAAATGGAACCATCCTTAT
GGAGACACACAAAACTGTTGGGCAACAGATGCTGAGCTTTCCTCACCTCCTGCAAACAGTGCTGCACATC
ATCCAGGTGGTCATAAGCTACTTCCTCATGCTCATCTTCATGACCTACAACGGGTACCTCTGCATTGCAG
TAGCAGCAGGGGCCGGTACAGGATACTTCCTCTTCAGCTGGAAGAAGGCAGTGGTAGTGGATATCACAGA
GCATTGCCAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201980 representing NM_001859
Red=Cloning site Green=Tags(s)

MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAGEMA
GAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHI
IQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001859
ORF Size 570 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001859.4
RefSeq Size 4735 bp
RefSeq ORF 573 bp
Locus ID 1317
UniProt ID O15431
Cytogenetics 9q32
Domains Ctr
Protein Families Transmembrane
MW 20.9 kDa
Summary The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:SLC31A1 (NM_001859) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201980L1 Lenti ORF clone of Human solute carrier family 31 (copper transporters), member 1 (SLC31A1), Myc-DDK-tagged 10 ug
$600.00
RC201980L2 Lenti ORF clone of Human solute carrier family 31 (copper transporters), member 1 (SLC31A1), mGFP tagged 10 ug
$600.00
RC201980L3 Lenti ORF clone of Human solute carrier family 31 (copper transporters), member 1 (SLC31A1), Myc-DDK-tagged 10 ug
$600.00
RC201980L4 Lenti ORF clone of Human solute carrier family 31 (copper transporters), member 1 (SLC31A1), mGFP tagged 10 ug
$600.00
RG201980 SLC31A1 (tGFP-tagged) - Human solute carrier family 31 (copper transporters), member 1 (SLC31A1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118985 SLC31A1 (untagged)-Human solute carrier family 31 (copper transporters), member 1 (SLC31A1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.