spindlin 1 (SPIN1) (NM_006717) Human Tagged ORF Clone

SKU
RC201938
SPIN1 (Myc-DDK-tagged)-Human spindlin 1 (SPIN1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol spindlin 1
Synonyms SPIN; TDRD24
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201938 representing NM_006717
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGACCCCATTCGGAAAGACACCTGGCCAGCGGTCCAGAGCTGATGCAGGCCATGCTGGAGTATCTG
CCAACATGATGAAGAAGAGGACATCCCACAAAAAACATCGGAGCAGTGTGGGTCCGAGCAAACCTGTTTC
CCAGCCCCGGCGGAACATCGTAGGCTGCAGGATTCAGCATGGGTGGAAAGAGGGGAATGGCCCTGTTACC
CAGTGGAAAGGAACCGTTCTGGACCAGGTGCCTGTAAATCCTTCTTTGTATCTTATAAAATACGATGGAT
TTGACTGTGTTTATGGACTAGAACTTAATAAAGATGAAAGAGTTTCTGCGCTTGAAGTCCTCCCTGATAG
AGTTGCGACATCTCGAATCAGCGATGCACACTTGGCAGACACAATGATTGGCAAAGCAGTGGAACATATG
TTTGAGACAGAGGATGGTTCTAAAGATGAGTGGAGGGGAATGGTCTTAGCACGTGCACCTGTCATGAACA
CATGGTTTTACATTACCTATGAGAAAGACCCTGTCTTGTACATGTACCAACTCTTAGATGATTACAAAGA
AGGCGACCTTCGCATTATGCCTGATTCCAATGATTCACCTCCAGCAGAAAGGGAACCAGGAGAAGTTGTG
GACAGCCTGGTAGGCAAACAAGTGGAATATGCCAAAGAAGATGGCTCGAAAAGGACTGGCATGGTCATTC
ATCAAGTAGAAGCCAAGCCCTCCGTCTATTTCATCAAGTTTGATGATGATTTCCATATTTATGTCTACGA
TTTGGTGAAAACATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201938 representing NM_006717
Red=Cloning site Green=Tags(s)

MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVT
QWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHM
FETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVV
DSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006717
ORF Size 786 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006717.3
RefSeq Size 4535 bp
RefSeq ORF 789 bp
Locus ID 10927
UniProt ID Q9Y657
Cytogenetics 9q22.1
Domains Spin-Ssty
MW 29.4 kDa
Summary Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway (PubMed:24589551). Overexpression induces metaphase arrest and chromosomal instability. Localizes to active rDNA loci and promotes the expression of rRNA genes (PubMed:21960006). May play a role in cell-cycle regulation during the transition from gamete to embryo. Involved in oocyte meiotic resumption, a process that takes place before ovulation to resume meiosis of oocytes blocked in prophase I: may act by regulating maternal transcripts to control meiotic resumption.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:spindlin 1 (SPIN1) (NM_006717) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201938L1 Lenti ORF clone of Human spindlin 1 (SPIN1), Myc-DDK-tagged 10 ug
$600.00
RC201938L2 Lenti ORF clone of Human spindlin 1 (SPIN1), mGFP tagged 10 ug
$600.00
RC201938L3 Lenti ORF clone of Human spindlin 1 (SPIN1), Myc-DDK-tagged 10 ug
$600.00
RC201938L4 Lenti ORF clone of Human spindlin 1 (SPIN1), mGFP tagged 10 ug
$600.00
RG201938 SPIN1 (tGFP-tagged) - Human spindlin 1 (SPIN1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC108548 SPIN1 (untagged)-Human spindlin 1 (SPIN1) 10 ug
$300.00
SC322356 SPIN1 (untagged)-Human spindlin 1 (SPIN1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.