MLX (NM_198204) Human Tagged ORF Clone

SKU
RC201911
MLX (Myc-DDK-tagged)-Human MAX-like protein X (MLX), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MLX
Synonyms bHLHd13; MAD7; MXD7; TCFL4; TF4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201911 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGAGCCGGGCGCCTCTCCCGAGGACCCTTGGGTCAAGGTGGAGTATGCCTACAGCGACAACAGCC
TGGACCCCGGGCTTTTTGTAGAAAGCACCCGCAAGGGGAGTGTAGTGTCCAGAGCTAATAGCATCGGTTC
CACCAGTGCCTCTTCTGTCCCCAACACAGATGATGAGGACAGTGATTACCACCAGGAGGCCTACAAGGAG
TCCTACAAAGACCGGCGGCGGCGCGCACACACTCAGGCTGAGCAGAAGAGGAGGGACGCCATCAAGAGAG
GCTATGATGACCTTCAGACCATCGTCCCCACTTGCCAGCAGCAGGACTTCTCCATTGGCTCCCAAAAGCT
CAGCAAAGCCATCGTTCTACAAAAGACCATTGACTACATTCAGTTTTTGCACAAGGAGAAGAAAAAGCAG
GAGGAGGAGGTGTCCACGTTACGCAAGGATGTCACCGCCCTAAAGATCATGAAAGTGAACTATGAGCAGA
TTGTGAAGGCACACCAGGACAACCCCCATGAAGGGGAGGACCAGGTCTCTGACCAGGTCAAGTTCAACGT
GTTTCAAGGCATCATGGATTCCCTGTTCCAGTCCTTCAATGCCTCCATCTCAGTGGCCAGCTTCCAGGAG
CTGTCAGCATGTGTCTTCAGCTGGATCGAGGAGCACTGTAAGCCTCAGACCCTGCGGGAGATTGTGATTG
GCGTCCTGCACCAATTGAAAAACCAGCTTTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201911 protein sequence
Red=Cloning site Green=Tags(s)

MTEPGASPEDPWVKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKE
SYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQ
EEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQE
LSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_198204
ORF Size 732 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_198204.1, NP_937847.1
RefSeq Size 2406 bp
RefSeq ORF 735 bp
Locus ID 6945
UniProt ID Q9UH92
Cytogenetics 17q21.2
Protein Families Druggable Genome, Transcription Factors
MW 27.9 kDa
Summary The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MLX (NM_198204) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201911L3 Lenti ORF clone of Human MAX-like protein X (MLX), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC201911L4 Lenti ORF clone of Human MAX-like protein X (MLX), transcript variant 2, mGFP tagged 10 ug
$600.00
RG201911 MLX (tGFP-tagged) - Human MAX-like protein X (MLX), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC109829 MLX (untagged)-Human MAX-like protein X (MLX), transcript variant 2 10 ug
$300.00
SC322389 MLX (untagged)-Human MAX-like protein X (MLX), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.