ASB9 (NM_001031739) Human Tagged ORF Clone

SKU
RC201901
ASB9 (Myc-DDK-tagged)-Human ankyrin repeat and SOCS box containing 9 (ASB9), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ASB9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201901 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGGCAAACAAGGGGGCATGGATGGGAGCAAGCCCGCGGGGCCAAGGGACTTTCCTGGCATCAGGC
TTCTTTCAAACCCATTGATGGGCGATGCTGTGTCTGATTGGTCTCCTATGCATGAAGCTGCAATCCACGG
ACATCAGCTGTCTCTGAGGAACCTCATCAGCCAGGGGTGGGCTGTGAACATCATCACGGCAGATCATGTT
TCCCCACTCCATGAAGCCTGTCTTGGAGGTCATCTCTCTTGTGTGAAGATTTTATTAAAGCATGGAGCTC
AGGTGAATGGTGTGACAGCAGACTGGCACACTCCACTGTTTAATGCTTGTGTCAGCGGCAGCTGGGATTG
TGTGAATTTGCTTCTGCAGCACGGAGCCAGCGTTCAACCTGAGAGTGATCTGGCATCCCCCATCCATGAA
GCTGCTAGGAGAGGCCACGTGGAGTGTGTCAACTCTCTTATAGCTTATGGGGGCAACATTGACCATAAGA
TCAGCCACCTGGGCACTCCACTCTATTTGGCTTGTGAAAACCAACAGAGAGCCTGTGTCAAGAAGCTTCT
GGAGTCAGGAGCGGACGTGAACCAAGGGAAAGGTCAGGATTCCCCACTTCATGCAGTGGCCAGGACAGCC
AGTGAAGAGCTGGCCTGCCTGCTCATGGATTTTGGAGCGGACACCCAGGCCAAGAATGCTGAAGGCAAAC
GTCCTGTGGAGCTGGTGCCTCCAGAGAGCCCCTTGGCCCAGCTCTTCTTGGAGAGAGAAGGGCCCCCTTC
TTTGATGCAGTTATGCCGCCTTAGAATTCGGAAGTGTTTTGGAATCCAGCAGCATCATAAGATAACCAAA
CTCGTCCTCCCAGAGGATCTGAAACAGTTTCTCCTACATCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201901 protein sequence
Red=Cloning site Green=Tags(s)

MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHV
SPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHE
AARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQRACVKKLLESGADVNQGKGQDSPLHAVARTA
SEELACLLMDFGADTQAKNAEGKRPVELVPPESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITK
LVLPEDLKQFLLHL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001031739
ORF Size 882 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001031739.3
RefSeq Size 1714 bp
RefSeq ORF 885 bp
Locus ID 140462
UniProt ID Q96DX5
Cytogenetics Xp22.2
Protein Families Druggable Genome
MW 31.9 kDa
Summary This gene encodes a member of the ankyrin repeat and suppressor of cytokine signaling (SOCS) box protein family. Members of this family can interact with the elongin B-C adapter complex via their SOCS box domain and further complex with the cullin and ring box proteins to form E3 ubiquitin ligase complexes. They may function to mediate the substrate-recognition of the E3 ubiquitin ligases. A transcribed pseudogene of this gene has been identified on chromosome 15. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]
Write Your Own Review
You're reviewing:ASB9 (NM_001031739) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201901L1 Lenti ORF clone of Human ankyrin repeat and SOCS box containing 9 (ASB9), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201901L2 Lenti ORF clone of Human ankyrin repeat and SOCS box containing 9 (ASB9), transcript variant 1, mGFP tagged 10 ug
$600.00
RC201901L3 Lenti ORF clone of Human ankyrin repeat and SOCS box containing 9 (ASB9), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201901L4 Lenti ORF clone of Human ankyrin repeat and SOCS box containing 9 (ASB9), transcript variant 1, mGFP tagged 10 ug
$600.00
RG201901 ASB9 (tGFP-tagged) - Human ankyrin repeat and SOCS box containing 9 (ASB9), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC322427 ASB9 (untagged)-Human ankyrin repeat and SOCS box containing 9 (ASB9), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.