FEN1 (NM_004111) Human Tagged ORF Clone

SKU
RC201785
FEN1 (Myc-DDK-tagged)-Human flap structure-specific endonuclease 1 (FEN1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FEN1
Synonyms FEN-1; MF1; RAD2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201785 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAATTCAAGGCCTGGCCAAACTAATTGCTGATGTGGCCCCCAGTGCCATCCGGGAGAATGACATCA
AGAGCTACTTTGGCCGTAAGGTGGCCATTGATGCCTCTATGAGCATTTATCAGTTCCTGATTGCTGTTCG
CCAGGGTGGGGATGTGCTGCAGAATGAGGAGGGTGAGACCACCAGCCACCTGATGGGCATGTTCTACCGC
ACCATTCGCATGATGGAGAACGGCATCAAGCCCGTGTATGTCTTTGATGGCAAGCCGCCACAGCTCAAGT
CAGGCGAGCTGGCCAAACGCAGTGAGCGGCGGGCTGAGGCAGAGAAGCAGCTGCAGCAGGCTCAGGCTGC
TGGGGCCGAGCAGGAGGTGGAAAAATTCACTAAGCGGCTGGTGAAGGTCACTAAGCAGCACAATGATGAG
TGCAAACATCTGCTGAGCCTCATGGGCATCCCTTATCTTGATGCACCCAGTGAGGCAGAGGCCAGCTGTG
CTGCCCTGGTGAAGGCTGGCAAAGTCTATGCTGCGGCTACCGAGGACATGGACTGCCTCACCTTCGGCAG
CCCTGTGCTAATGCGACACCTGACTGCCAGTGAAGCCAAAAAGCTGCCAATCCAGGAATTCCACCTGAGC
CGGATTCTGCAGGAGCTGGGCCTGAACCAGGAACAGTTTGTGGATCTGTGCATCCTGCTAGGCAGTGACT
ACTGTGAGAGTATCCGGGGTATTGGGCCCAAGCGGGCTGTGGACCTCATCCAGAAGCACAAGAGCATCGA
GGAGATCGTGCGGCGACTTGACCCCAACAAGTACCCTGTGCCAGAAAATTGGCTCCACAAGGAGGCTCAC
CAGCTCTTCTTGGAACCTGAGGTGCTGGACCCAGAGTCTGTGGAGCTGAAGTGGAGCGAGCCAAATGAAG
AAGAGCTGATCAAGTTCATGTGTGGTGAAAAGCAGTTCTCTGAGGAGCGAATCCGCAGTGGGGTCAAGAG
GCTGAGTAAGAGCCGCCAAGGCAGCACCCAGGGCCGCCTGGATGATTTCTTCAAGGTGACCGGCTCACTC
TCTTCAGCTAAGCGCAAGGAGCCAGAACCCAAGGGATCCACTAAGAAGAAGGCAAAGACTGGGGCAGCAG
GGAAGTTTAAAAGGGGAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201785 protein sequence
Red=Cloning site Green=Tags(s)

MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYR
TIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDE
CKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLS
RILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAH
QLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL
SSAKRKEPEPKGSTKKKAKTGAAGKFKRGK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004111
ORF Size 1140 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004111.6
RefSeq Size 2308 bp
RefSeq ORF 1143 bp
Locus ID 2237
UniProt ID P39748
Cytogenetics 11q12.2
Domains HhH2, XPG_I, XPG_N
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Base excision repair, DNA replication, Non-homologous end-joining
MW 42.6 kDa
Summary The protein encoded by this gene removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:FEN1 (NM_004111) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201785L1 Lenti ORF clone of Human flap structure-specific endonuclease 1 (FEN1), Myc-DDK-tagged 10 ug
$986.00
RC201785L2 Lenti ORF clone of Human flap structure-specific endonuclease 1 (FEN1), mGFP tagged 10 ug
$986.00
RC201785L3 Lenti ORF clone of Human flap structure-specific endonuclease 1 (FEN1), Myc-DDK-tagged 10 ug
$986.00
RC201785L4 Lenti ORF clone of Human flap structure-specific endonuclease 1 (FEN1), mGFP tagged 10 ug
$986.00
RG201785 FEN1 (tGFP-tagged) - Human flap structure-specific endonuclease 1 (FEN1) 10 ug
$886.00
SC110892 FEN1 (untagged)-Human flap structure-specific endonuclease 1 (FEN1) 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.