LSM4 (NM_012321) Human Tagged ORF Clone
SKU
RC201769
LSM4 (Myc-DDK-tagged)-Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | LSM4 |
Synonyms | GRP; YER112W |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC201769 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTTCCCTTGTCACTGCTGAAGACGGCTCAGAATCACCCCATGTTGGTGGAGCTGAAAAATGGGGAGA CGTACAATGGACACCTGGTGAGCTGCGACAACTGGATGAACATTAACCTGCGAGAAGTCATCTGCACGTC CAGGGACGGGGACAAGTTCTGGCGGATGCCCGAGTGCTACATCCGCGGCAGCACCATCAAGTACCTGCGC ATCCCCGACGAGATCATCGACATGGTCAAGGAGGAGGTGGTGGCCAAGGGCCGCGGCCGCGGAGGCCTGC AGCAGCAGAAGCAGCAGAAAGGCCGCGGCATGGGCGGCGCTGGCCGAGGTGTGTTTGGTGGCCGGGGCCG AGGTGGGATCCCGGGCACAGGCAGAGGCCAGCCAGAGAAGAAGCCTGGCAGACAGGCGGGCAAACAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201769 protein sequence
Red=Cloning site Green=Tags(s) MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLR IPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_012321 |
ORF Size | 417 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_012321.5 |
RefSeq Size | 1825 bp |
RefSeq ORF | 420 bp |
Locus ID | 25804 |
UniProt ID | Q9Y4Z0 |
Cytogenetics | 19p13.11 |
Domains | Sm |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation, Spliceosome |
MW | 15.3 kDa |
Summary | This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC201769L1 | Lenti ORF clone of Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC201769L2 | Lenti ORF clone of Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), mGFP tagged | 10 ug |
$450.00
|
|
RC201769L3 | Lenti ORF clone of Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC201769L4 | Lenti ORF clone of Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), mGFP tagged | 10 ug |
$450.00
|
|
RG201769 | LSM4 (tGFP-tagged) - Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4) | 10 ug |
$489.00
|
|
SC115451 | LSM4 (untagged)-Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.