PEX19 (NM_002857) Human Tagged ORF Clone

SKU
RC201756
PEX19 (Myc-DDK-tagged)-Human peroxisomal biogenesis factor 19 (PEX19), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PEX19
Synonyms D1S2223E; HK33; PBD12A; PMP1; PMPI; PXF; PXMP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201756 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCCGCTGAGGAAGGCTGTAGTGTCGGGGCCGAAGCGGACAGGGAATTGGAGGAGCTTCTGGAAA
GTGCTCTTGATGATTTCGATAAAGCCAAACCCTCCCCAGCACCCCCTTCTACCACCACGGCCCCTGATGC
TTCGGGGCCCCAGAAGAGATCGCCAGGAGACACTGCCAAAGATGCCCTCTTCGCTTCCCAAGAGAAGTTT
TTCCAGGAACTATTCGACAGTGAACTGGCTTCCCAAGCCACTGCGGAGTTCGAGAAGGCAATGAAGGAGT
TGGCTGAGGAAGAACCCCACCTGGTGGAGCAGTTCCAAAAGCTCTCAGAGGCTGCAGGGAGAGTGGGCAG
TGATATGACCTCCCAACAAGAATTCACTTCTTGCCTAAAGGAAACACTAAGTGGATTAGCCAAAAATGCC
ACTGACCTTCAGAACTCCAGCATGTCGGAAGAAGAGCTGACCAAGGCCATGGAGGGGCTAGGCATGGACG
AAGGGGATGGGGAAGGGAACATCCTCCCCATCATGCAGAGTATTATGCAGAACCTACTCTCCAAGGATGT
GCTGTACCCATCACTGAAGGAGATCACAGAAAAGTATCCAGAATGGTTGCAGAGTCATCGGGAATCTCTA
CCTCCAGAGCAGTTTGAAAAATATCAGGAGCAGCACAGCGTCATGTGCAAAATATGTGAGCAGTTTGAGG
CAGAGACCCCCACAGACAGTGAAACCACTCAAAAGGCTCGTTTTGAGATGGTGCTGGATCTTATGCAGCA
GCTACAAGATTTAGGCCATCCTCCAAAAGAGCTGGCTGGAGAGATGCCTCCTGGCCTCAACTTTGACCTG
GATGCCCTCAATCTTTCGGGCCCACCAGGTGCCAGTGGTGAACAGTGTCTGATCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201756 protein sequence
Red=Cloning site Green=Tags(s)

MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKF
FQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNA
TDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESL
PPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDL
DALNLSGPPGASGEQCLIM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002857
ORF Size 897 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002857.4
RefSeq Size 3722 bp
RefSeq ORF 900 bp
Locus ID 5824
UniProt ID P40855
Cytogenetics 1q23.2
Domains Pex19
Protein Families Druggable Genome
MW 32.8 kDa
Summary This gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. These disorders have at least 14 complementation groups, with more than one phenotype being observed for some complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS), as well as peroxisome biogenesis disorder complementation group 14 (PBD-CG14), which is also known as PBD-CGJ. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2010]
Write Your Own Review
You're reviewing:PEX19 (NM_002857) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201756L3 Lenti ORF clone of Human peroxisomal biogenesis factor 19 (PEX19), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201756L4 Lenti ORF clone of Human peroxisomal biogenesis factor 19 (PEX19), transcript variant 1, mGFP tagged 10 ug
$600.00
RG201756 PEX19 (tGFP-tagged) - Human peroxisomal biogenesis factor 19 (PEX19), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC320225 PEX19 (untagged)-Human peroxisomal biogenesis factor 19 (PEX19), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.