GC1q R (C1QBP) (NM_001212) Human Tagged ORF Clone

SKU
RC201742
C1QBP (Myc-DDK-tagged)-Human complement component 1, q subcomponent binding protein (C1QBP), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
5 Days*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GC1q R
Synonyms COXPD33; gC1Q-R; GC1QBP; gC1qR; HABP1; p32; SF2AP32; SF2p32
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201742 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCCTCTGCTGCGCTGCGTGCCCCGTGTGCTGGGCTCCTCCGTCGCCGGCCTCCGCGCTGCCGCGC
CCGCCTCGCCTTTCCGGCAGCTCCTGCAGCCGGCACCCCGGCTGTGCACCCGGCCCTTCGGGCTGCTCAG
CGTGCGCGCAGGTTCCGAGCGGCGGCCGGGCCTCCTGCGGCCTCGCGGACCCTGCGCCTGTGGCTGTGGC
TGCGGCTCGCTGCACACCGACGGAGACAAAGCTTTTGTTGATTTCCTGAGTGATGAAATTAAGGAGGAAA
GAAAAATTCAGAAGCATAAAACCCTCCCTAAGATGTCTGGAGGTTGGGAGCTGGAACTGAATGGGACAGA
AGCGAAATTAGTGCGGAAAGTTGCCGGGGAAAAAATCACGGTCACTTTCAACATTAACAACAGCATCCCA
CCAACATTTGATGGTGAGGAGGAACCCTCGCAAGGGCAGAAGGTTGAAGAACAGGAGCCTGAACTGACAT
CAACTCCCAATTTCGTGGTTGAAGTTATAAAGAATGATGATGGCAAGAAGGCCCTTGTGTTGGACTGTCA
TTATCCAGAGGATGAGGTTGGACAAGAAGACGAGGCTGAGAGTGACATCTTCTCTATCAGGGAAGTTAGC
TTTCAGTCCACTGGCGAGTCTGAATGGAAGGATACTAATTATACACTCAACACAGATTCCTTGGACTGGG
CCTTATATGACCACCTAATGGATTTCCTTGCCGACCGAGGGGTGGACAACACTTTTGCAGATGAGCTGGT
GGAGCTCAGCACAGCCCTGGAGCACCAGGAGTACATTACTTTTCTTGAAGACCTCAAGAGTTTTGTCAAG
AGCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201742 protein sequence
Red=Cloning site Green=Tags(s)

MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCG
CGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIP
PTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVS
FQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVK
SQ

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001212
ORF Size 846 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001212.4
RefSeq Size 1163 bp
RefSeq ORF 849 bp
Locus ID 708
UniProt ID Q07021
Cytogenetics 17p13.2
Domains MAM33
MW 31.4 kDa
Summary The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GC1q R (C1QBP) (NM_001212) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201742L1 Lenti-ORF clone of C1QBP (Myc-DDK-tagged)-Human complement component 1, q subcomponent binding protein (C1QBP), nuclear gene encoding mitochondrial protein 10 ug
$750.00
RC201742L2 Lenti-ORF clone of C1QBP (mGFP-tagged)-Human complement component 1, q subcomponent binding protein (C1QBP), nuclear gene encoding mitochondrial protein 10 ug
$750.00
RC201742L3 Lenti-ORF clone of C1QBP (Myc-DDK-tagged)-Human complement component 1, q subcomponent binding protein (C1QBP), nuclear gene encoding mitochondrial protein 10 ug
$750.00
RC201742L4 Lenti-ORF clone of C1QBP (mGFP-tagged)-Human complement component 1, q subcomponent binding protein (C1QBP), nuclear gene encoding mitochondrial protein 10 ug
$750.00
RG201742 C1QBP (tGFP-tagged) - Human complement component 1, q subcomponent binding protein (C1QBP), nuclear gene encoding mitochondrial protein 10 ug
$650.00
SC107905 C1QBP (untagged)-Human complement component 1, q subcomponent binding protein (C1QBP), nuclear gene encoding mitochondrial protein 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.