CREG1 (NM_003851) Human Tagged ORF Clone

SKU
RC201654
CREG1 (Myc-DDK-tagged)-Human cellular repressor of E1A-stimulated genes 1 (CREG1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CREG1
Synonyms CREG
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201654 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGGGCTATCCCGCGGGTCCGCGCGCGCACTGCTCGCCGCCCTGCTGGCGTCGACGCTGTTGGCGC
TGCTCGTGTCGCCCGCGCGGGGTCGCGGCGGCCGGGACCACGGGGACTGGGACGAGGCCTCCCGGCTGCC
GCCGCTACCACCCCGCGAGGACGCGGCGCGCGTGGCCCGCTTCGTGACGCACGTCTCCGACTGGGGCGCT
CTGGCCACCATCTCCACGCTGGAGGCGGTGCGCGGCCGGCCCTTCGCCGACGTCCTCTCGCTCAGCGACG
GGCCCCCGGGCGCGGGCAGCGGCGTGCCCTATTTCTACCTGAGCCCGCTGCAGCTCTCCGTGAGCAACCT
GCAGGAGAATCCATATGCTACACTGACCATGACTTTGGCACAGACCAACTTCTGCAAGAAACATGGATTT
GATCCACAAAGTCCCCTTTGTGTTCACATAATGCTGTCAGGAACTGTGACCAAGGTGAATGAAACAGAAA
TGGATATTGCAAAGCATTCGTTATTCATTCGACACCCTGAGATGAAAACCTGGCCTTCCAGCCATAATTG
GTTCTTTGCTAAGTTGAATATAACCAATATCTGGGTCCTGGACTACTTTGGTGGACCAAAAATCGTGACA
CCAGAAGAATATTATAATGTCACAGTTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201654 protein sequence
Red=Cloning site Green=Tags(s)

MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLPPREDAARVARFVTHVSDWGA
LATISTLEAVRGRPFADVLSLSDGPPGAGSGVPYFYLSPLQLSVSNLQENPYATLTMTLAQTNFCKKHGF
DPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVT
PEEYYNVTVQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003851
ORF Size 660 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003851.3
RefSeq Size 2048 bp
RefSeq ORF 663 bp
Locus ID 8804
UniProt ID O75629
Cytogenetics 1q24.2
Protein Families Secreted Protein, Transcription Factors, Transmembrane
MW 24.1 kDa
Summary The adenovirus E1A protein both activates and represses gene expression to promote cellular proliferation and inhibit differentiation. The protein encoded by this gene antagonizes transcriptional activation and cellular transformation by E1A. This protein shares limited sequence similarity with E1A and binds both the general transcription factor TBP and the tumor suppressor pRb in vitro. This gene may contribute to the transcriptional control of cell growth and differentiation. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CREG1 (NM_003851) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201654L3 Lenti ORF clone of Human cellular repressor of E1A-stimulated genes 1 (CREG1), Myc-DDK-tagged 10 ug
$600.00
RC201654L4 Lenti ORF clone of Human cellular repressor of E1A-stimulated genes 1 (CREG1), mGFP tagged 10 ug
$600.00
RG201654 CREG1 (tGFP-tagged) - Human cellular repressor of E1A-stimulated genes 1 (CREG1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC117715 CREG1 (untagged)-Human cellular repressor of E1A-stimulated genes 1 (CREG1) 10 ug
$300.00
SC322215 CREG1 (untagged)-Human cellular repressor of E1A-stimulated genes 1 (CREG1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.