DNAJB6 (NM_005494) Human Tagged ORF Clone

SKU
RC201620
DNAJB6 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DNAJB6
Synonyms DJ4; DnaJ; HHDJ1; HSJ-2; HSJ2; LGMD1D; LGMD1E; LGMDD1; MRJ; MSJ-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201620 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGATTACTATGAAGTTCTAGGCGTGCAGAGACATGCCTCACCCGAGGATATTAAAAAGGCATATC
GGAAACTGGCACTGAAGTGGCATCCAGATAAAAATCCTGAGAATAAAGAAGAAGCAGAGAGAAAATTCAA
GCAAGTAGCGGAGGCATATGAAGTGCTGTCGGATGCTAAGAAACGGGACATCTATGACAAATATGGCAAA
GAAGGATTAAATGGTGGAGGAGGAGGTGGAAGTCATTTTGACAGTCCATTTGAATTTGGCTTCACATTCC
GTAACCCAGATGATGTCTTCAGGGAATTTTTTGGTGGAAGGGACCCATTTTCATTTGACTTCTTTGAAGA
CCCTTTTGAGGACTTCTTTGGGAATCGAAGGGGTCCCCGAGGAAGCAGAAGCCGAGGGACGGGGTCGTTT
TTCTCTGCGTTCAGTGGATTTCCGTCTTTTGGAAGTGGATTTTCTTCTTTTGATACAGGATTTACTTCAT
TTGGGTCACTAGGTCACGGGGGCCTCACTTCATTCTCTTCCACGTCATTTGGTGGTAGTGGCATGGGCAA
CTTCAAATCGATATCAACTTCAACTAAAATGGTTAATGGCAGAAAAATCACTACAAAGAGAATTGTCGAG
AACGGTCAAGAAAGAGTAGAAGTTGAAGAAGATGGCCAGTTAAAGTCCTTAACAATAAATGGTAAGGAGC
AGCTGCTGCGCTTGGATAACAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201620 protein sequence
Red=Cloning site Green=Tags(s)

MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGK
EGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSF
FSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVE
NGQERVEVEEDGQLKSLTINGKEQLLRLDNK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005494
ORF Size 723 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005494.3
RefSeq Size 1568 bp
RefSeq ORF 726 bp
Locus ID 10049
UniProt ID O75190
Cytogenetics 7q36.3
Domains DnaJ
MW 26.9 kDa
Summary This gene encodes a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DNAJB6 (NM_005494) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201620L1 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC201620L2 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2, mGFP tagged 10 ug
$600.00
RC201620L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC201620L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2, mGFP tagged 10 ug
$600.00
RG201620 DNAJB6 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC110111 DNAJB6 (untagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2 10 ug
$300.00
SC322162 DNAJB6 (untagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.