CSRP2 (NM_001321) Human Tagged ORF Clone

SKU
RC201565
CSRP2 (Myc-DDK-tagged)-Human cysteine and glycine-rich protein 2 (CSRP2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CSRP2
Synonyms CRP2; LMO5; SmLIM
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201565 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGTCTGGGGAGGTGGAAACAAGTGTGGGGCCTGTGGGAGGACCGTGTACCACGCAGAAGAGGTGC
AGTGTGATGGCAGGAGCTTCCACCGCTGCTGCTTTCTCTGCATGGTTTGCAGGAAAAATTTAGATAGCAC
AACAGTGGCAATTCACGATGAAGAGATCTACTGCAAATCCTGCTACGGAAAGAAGTATGGGCCAAAAGGC
TACGGTTATGGCCAGGGCGCTGGCACGCTTAACATGGACCGTGGCGAGAGGCTGGGCATCAAACCAGAGA
GTGTTCAGCCTCACAGGCCTACAACAAATCCAAACACTTCTAAATTTGCTCAGAAATATGGAGGTGCTGA
GAAGTGTTCCAGATGTGGGGATTCTGTATATGCTGCCGAGAAGATAATTGGAGCTGGAAAGCCCTGGCAC
AAAAACTGTTTCCGATGTGCAAAGTGTGGGAAGAGTCTTGAATCAACAACTCTGACTGAAAAAGAAGGTG
AAATCTATTGTAAAGGATGCTATGCAAAGAACTTTGGGCCCAAGGGATTTGGCTATGGCCAAGGAGCAGG
GGCTCTTGTTCATGCCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201565 protein sequence
Red=Cloning site Green=Tags(s)

MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKG
YGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWH
KNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001321
ORF Size 579 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001321.3
RefSeq Size 940 bp
RefSeq ORF 582 bp
Locus ID 1466
UniProt ID Q16527
Cytogenetics 12q21.2
Domains LIM
MW 21 kDa
Summary CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Write Your Own Review
You're reviewing:CSRP2 (NM_001321) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201565L1 Lenti ORF clone of Human cysteine and glycine-rich protein 2 (CSRP2), Myc-DDK-tagged 10 ug
$600.00
RC201565L2 Lenti ORF clone of Human cysteine and glycine-rich protein 2 (CSRP2), mGFP tagged 10 ug
$600.00
RC201565L3 Lenti ORF clone of Human cysteine and glycine-rich protein 2 (CSRP2), Myc-DDK-tagged 10 ug
$600.00
RC201565L4 Lenti ORF clone of Human cysteine and glycine-rich protein 2 (CSRP2), mGFP tagged 10 ug
$600.00
RG201565 CSRP2 (tGFP-tagged) - Human cysteine and glycine-rich protein 2 (CSRP2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC119303 CSRP2 (untagged)-Human cysteine and glycine-rich protein 2 (CSRP2) 10 ug
$300.00
SC322165 CSRP2 (untagged)-Human cysteine and glycine-rich protein 2 (CSRP2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.