NXT1 (NM_013248) Human Tagged ORF Clone

SKU
RC201510
NXT1 (Myc-DDK-tagged)-Human NTF2-like export factor 1 (NXT1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NXT1
Synonyms MTR2; P15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201510 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCATCTGTGGATTTCAAGACCTATGTGGATCAGGCCTGCAGAGCTGCTGAGGAGTTTGTCAATGTCT
ACTACACCACCATGGATAAGCGGCGGCGTTTGCTGTCCCGCCTGTACATGGGCACAGCCACCCTGGTCTG
GAATGGCAATGCTGTTTCAGGACAAGAATCCTTGAGTGAGTTTTTTGAAATGTTGCCTTCCAGCGAGTTC
CAAATCAGCGTGGTAGACTGCCAGCCTGTTCATGATGAAGCCACACCAAGCCAGACCACGGTCCTTGTTG
TCATCTGTGGATCAGTGAAGTTTGAGGGGAACAAACAACGGGACTTCAACCAGAACTTCATCCTGACCGC
CCAGGCCTCACCCAGCAACACAGTGTGGAAGATCGCAAGTGACTGCTTCCGCTTCCAGGACTGGGCCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201510 protein sequence
Red=Cloning site Green=Tags(s)

MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEF
QISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_013248
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013248.3
RefSeq Size 1176 bp
RefSeq ORF 423 bp
Locus ID 29107
UniProt ID Q9UKK6
Cytogenetics 20p11.21
Domains NTF2
MW 15.8 kDa
Summary The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NXT1 (NM_013248) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201510L1 Lenti ORF clone of Human NTF2-like export factor 1 (NXT1), Myc-DDK-tagged 10 ug
$450.00
RC201510L2 Lenti ORF clone of Human NTF2-like export factor 1 (NXT1), mGFP tagged 10 ug
$450.00
RC201510L3 Lenti ORF clone of Human NTF2-like export factor 1 (NXT1), Myc-DDK-tagged 10 ug
$450.00
RC201510L4 Lenti ORF clone of Human NTF2-like export factor 1 (NXT1), mGFP tagged 10 ug
$450.00
RG201510 NXT1 (tGFP-tagged) - Human NTF2-like export factor 1 (NXT1) 10 ug
$489.00
SC115348 NXT1 (untagged)-Human NTF2-like export factor 1 (NXT1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.