SPCS1 (NM_014041) Human Tagged ORF Clone

SKU
RC201472
SPCS1 (Myc-DDK-tagged)-Human signal peptidase complex subunit 1 homolog (S. cerevisiae) (SPCS1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SPCS1
Synonyms HSPC033; SPC1; SPC12; YJR010C-A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201472 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGAGCATCTGAGCTCGCTGCCCACGCAGATGGATTACAAGGGCCAGAAGCTAGCTGAACAGATGT
TTCAGGGAATTATTCTTTTTTCTGCAATAGTTGGATTTATCTACGGGTACGTGGCTGAACAGTTCGGGTG
GACTGTCTATATAGTTATGGCCGGATTTGCTTTTTCATGTTTGGCCCAGCTGACACTTCCTCCATGGCCC
ATCTATCGCCGGCATCCTCTCAAGTGGTTACCTGTTCAAGAATCAAGCACAGACGACAAGAAACCAGGGG
AAAGAAAAATTAAGAGGCATGCTAAAAATAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201472 protein sequence
Red=Cloning site Green=Tags(s)

MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLAQLTLPPWP
IYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014041
ORF Size 312 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014041.2, NP_054760.2
RefSeq Size 1100 bp
RefSeq ORF 309 bp
Locus ID 28972
UniProt ID Q9Y6A9
Cytogenetics 3p21.1
Protein Families Protease, Transmembrane
MW 12 kDa
Summary Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SPCS1 (NM_014041) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201472L3 Lenti ORF clone of Human signal peptidase complex subunit 1 homolog (S. cerevisiae) (SPCS1), Myc-DDK-tagged 10 ug
$450.00
RC201472L4 Lenti ORF clone of Human signal peptidase complex subunit 1 homolog (S. cerevisiae) (SPCS1), mGFP tagged 10 ug
$450.00
RG201472 SPCS1 (tGFP-tagged) - Human signal peptidase complex subunit 1 homolog (S. cerevisiae) (SPCS1) 10 ug
$489.00
SC115189 SPCS1 (untagged)-Human signal peptidase complex subunit 1 homolog (S. cerevisiae) (SPCS1) 10 ug
$150.00
SC322217 SPCS1 (untagged)-Human signal peptidase complex subunit 1 homolog (S. cerevisiae) (SPCS1) 10 ug
$150.00
SC327744 SPCS1 (untagged)-Human signal peptidase complex subunit 1 homolog (S. cerevisiae) (SPCS1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.