NR2F6 (NM_005234) Human Tagged ORF Clone

SKU
RC201336
NR2F6 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 6 (NR2F6)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NR2F6
Synonyms EAR-2; EAR2; ERBAL2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201336 representing NM_005234
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCATGGTGACCGGCGGCTGGGGCGGCCCCGGCGGCGACACGAACGGCGTGGACAAGGCGGGCGGCT
ACCCGCGCGCGGCCGAGGACGACTCGGCCTCGCCCCCCGGTGCCGCCAGCGACGCCGAGCCGGGCGACGA
GGAGCGGCCGGGGCTGCAGGTGGACTGCGTGGTGTGCGGGGACAAGTCGAGCGGCAAGCATTACGGTGTC
TTCACCTGCGAGGGCTGCAAGAGCTTTTTCAAGCGAAGCATCCGCCGCAACCTCAGCTACACCTGCCGGT
CCAACCGTGACTGCCAGATCGACCAGCACCACCGGAACCAGTGCCAGTACTGCCGTCTCAAGAAGTGCTT
CCGGGTGGGCATGAGGAAGGAGGCGGTGCAGCGCGGCCGCATCCCGCACTCGCTGCCTGGTGCCGTGGCC
GCCTCCTCGGGCAGCCCCCCGGGCTCGGCGCTGGCGGCAGTGGCGAGCGGCGGAGACCTCTTCCCGGGGC
AGCCGGTGTCCGAACTGATCGCGCAGCTGCTGCGCGCTGAGCCCTACCCTGCGGCGGCCGGACGCTTCGG
CGCAGGGGGCGGCGCGGCGGGCGCGGTGCTGGGCATCGACAACGTGTGCGAGCTGGCGGCGCGGCTGCTC
TTCAGCACCGTGGAGTGGGCGCGCCACGCGCCCTTCTTCCCCGAGCTGCCGGTGGCCGACCAGGTGGCGC
TGCTGCGCCTGAGCTGGAGCGAGCTCTTCGTGCTGAACGCGGCGCAGGCGGCGCTGCCCCTGCACACGGC
GCCGCTACTGGCCGCCGCCGGCCTCCACGCCGCGCCTATGGCCGCCGAGCGCGCCGTGGCTTTCATGGAC
CAGGTGCGCGCCTTCCAGGAGCAGGTGGACAAGCTGGGCCGCCTGCAGGTCGACTCGGCCGAGTATGGCT
GCCTCAAGGCCATCGCGCTCTTCACGCCCGACGCCTGTGGCCTCTCAGACCCGGCCCACGTTGAGAGCCT
GCAGGAGAAGGCGCAGGTGGCCCTCACCGAGTATGTGCGGGCGCAGTACCCGTCCCAGCCCCAGCGCTTC
GGGCGCCTGCTGCTGCGGCTCCCCGCCCTGCGCGCGGTCCCTGCCTCCCTCATCTCCCAGCTGTTCTTCA
TGCGCCTGGTGGGGAAGACGCCCATTGAGACACTGATCAGAGACATGCTGCTGTCGGGGAGTACCTTCAA
CTGGCCCTACGGCTCGGGCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201336 representing NM_005234
Red=Cloning site Green=Tags(s)

MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
FTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVA
ASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLL
FSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMD
QVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRF
GRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005234
ORF Size 1212 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005234.3, NP_005225.2
RefSeq Size 1804 bp
RefSeq ORF 1215 bp
Locus ID 2063
UniProt ID P10588
Cytogenetics 19p13.11
Domains HOLI, zf-C4
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
MW 42.8 kDa
Summary Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NR2F6 (NM_005234) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201336L1 Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), Myc-DDK-tagged 10 ug
$986.00
RC201336L2 Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), mGFP tagged 10 ug
$986.00
RC201336L3 Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), Myc-DDK-tagged 10 ug
$986.00
RC201336L4 Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 6 (NR2F6), mGFP tagged 10 ug
$986.00
RG201336 NR2F6 (tGFP-tagged) - Human nuclear receptor subfamily 2, group F, member 6 (NR2F6) 10 ug
$489.00 MSRP $886.00 MSRP $886.00
SC116862 NR2F6 (untagged)-Human nuclear receptor subfamily 2, group F, member 6 (NR2F6) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.