TRAPPC6A (NM_024108) Human Tagged ORF Clone

SKU
RC201311
TRAPPC6A (Myc-DDK-tagged)-Human trafficking protein particle complex 6A (TRAPPC6A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TRAPPC6A
Synonyms TRS33
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201311 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGATACTGTGTTGTTTGAGTTTCTTCACACGGAGATGGTGGCTGAGCTGTGGGCTCACGACCCCG
ACCCCGGCCCGGGGGTGAGCGCCGGGCTCCGTGGGGAGGAAGCGGGGGCCACCAAGGGACAGAAGATGAG
CCTGTCGGTCCTGGAGGGTATGGGGTTCCGTGTGGGCCAGGCTCTAGGCGAGAGGCTGCCCCGGGAGACG
CTGGCCTTCAGGGAGGAGCTGGATGTCCTCAAGTTCTTGTGCAAAGACCTGTGGGTGGCGGTGTTCCAGA
AGCAGATGGACAGCCTGCGCACCAATCACCAGGGGACCTACGTCCTGCAAGACAACAGCTTCCCCCTCCT
CCTCCCGATGGCCTCTGGCCTGCAGTATCTGGAGGAAGCACCCAAGTTCCTGGCCTTCACCTGCGGCCTC
CTGCGCGGCGCCCTCTATACCCTGGGCATTGAGAGCGTGGTCACCGCCTCCGTGGCAGCCCTGCCCGTCT
GTAAGTTCCAGGTGGTGATTCCGAAATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201311 protein sequence
Red=Cloning site Green=Tags(s)

MADTVLFEFLHTEMVAELWAHDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRET
LAFREELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFLAFTCGL
LRGALYTLGIESVVTASVAALPVCKFQVVIPKS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024108
ORF Size 519 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024108.3
RefSeq Size 838 bp
RefSeq ORF 522 bp
Locus ID 79090
UniProt ID O75865
Cytogenetics 19q13.32
MW 18.9 kDa
Summary This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. Loss of expression of the related gene in mouse affects coat and eye pigmentation, suggesting that the encoded protein may be involved in melanosome biogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]
Write Your Own Review
You're reviewing:TRAPPC6A (NM_024108) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201311L3 Lenti ORF clone of Human trafficking protein particle complex 6A (TRAPPC6A), Myc-DDK-tagged 10 ug
$600.00
RC201311L4 Lenti ORF clone of Human trafficking protein particle complex 6A (TRAPPC6A), mGFP tagged 10 ug
$600.00
RG201311 TRAPPC6A (tGFP-tagged) - Human trafficking protein particle complex 6A (TRAPPC6A) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC122952 TRAPPC6A (untagged)-Human trafficking protein particle complex 6A (TRAPPC6A) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.