CD7 (NM_006137) Human Tagged ORF Clone

SKU
RC201231
CD7 (Myc-DDK-tagged)-Human CD7 molecule (CD7)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD7
Synonyms GP40; LEU-9; Tp40; TP41
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201231 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGGGCCTCCGAGGCTCCTGCTGCTGCCCCTGCTTCTGGCGCTGGCTCGCGGCCTGCCTGGGGCCC
TGGCTGCCCAAGAGGTGCAGCAGTCTCCCCACTGCACGACTGTCCCCGTGGGAGCCTCCGTCAACATCAC
CTGCTCCACCAGCGGGGGCCTGCGTGGGATCTACCTGAGGCAGCTCGGGCCACAGCCCCAAGACATCATT
TACTACGAGGACGGGGTGGTGCCCACTACGGACAGACGGTTCCGGGGCCGCATCGACTTCTCAGGGTCCC
AGGACAACCTGACTATCACCATGCACCGCCTGCAGCTGTCGGACACTGGCACCTACACCTGCCAGGCCAT
CACGGAGGTCAATGTCTACGGCTCCGGCACCCTGGTCCTGGTGACAGAGGAACAGTCCCAAGGATGGCAC
AGATGCTCGGACGCCCCACCAAGGGCCTCTGCCCTCCCTGCCCCACCGACAGGCTCCGCCCTCCCTGACC
CGCAGACAGCCTCTGCCCTCCCTGACCCGCCAGCAGCCTCTGCCCTCCCTGCGGCCCTGGCGGTGATCTC
CTTCCTCCTCGGGCTGGGCCTGGGGGTGGCGTGTGTGCTGGCGAGGACACAGATAAAGAAACTGTGCTCG
TGGCGGGATAAGAATTCGGCGGCATGTGTGGTGTACGAGGACATGTCGCACAGCCGCTGCAACACGCTGT
CCTCCCCCAACCAGTACCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201231 protein sequence
Red=Cloning site Green=Tags(s)

MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDII
YYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWH
RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCS
WRDKNSAACVVYEDMSHSRCNTLSSPNQYQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006137
ORF Size 720 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006137.7
RefSeq Size 1318 bp
RefSeq ORF 723 bp
Locus ID 924
UniProt ID P09564
Cytogenetics 17q25.3
Domains ig, IG, IGv
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage
MW 25.4 kDa
Summary This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CD7 (NM_006137) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201231L1 Lenti ORF clone of Human CD7 molecule (CD7), Myc-DDK-tagged 10 ug
$600.00
RC201231L2 Lenti ORF clone of Human CD7 molecule (CD7), mGFP tagged 10 ug
$600.00
RC201231L3 Lenti ORF clone of Human CD7 molecule (CD7), Myc-DDK-tagged 10 ug
$600.00
RC201231L4 Lenti ORF clone of Human CD7 molecule (CD7), mGFP tagged 10 ug
$600.00
RG201231 CD7 (tGFP-tagged) - Human CD7 molecule (CD7) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116265 CD7 (untagged)-Human CD7 molecule (CD7) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.