S100 alpha 2 (S100A2) (NM_005978) Human Tagged ORF Clone

SKU
RC201203
S100A2 (Myc-DDK-tagged)-Human S100 calcium binding protein A2 (S100A2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol S100 alpha 2
Synonyms CAN19; S100L
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201203 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGTGCAGTTCTCTGGAGCAGGCGCTGGCTGTGCTGGTCACTACCTTCCACAAGTACTCCTGCCAAG
AGGGCGACAAGTTCAAGCTGAGTAAGGGGGAAATGAAGGAACTTCTGCACAAGGAGCTGCCCAGCTTTGT
GGGGGAGAAAGTGGATGAGGAGGGGCTGAAGAAGCTGATGGGCAGCCTGGATGAGAACAGTGACCAGCAG
GTGGACTTCCAGGAGTATGCTGTTTTCCTGGCACTCATCACTGTCATGTGCAATGACTTCTTCCAGGGCT
GCCCAGACCGACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201203 protein sequence
Red=Cloning site Green=Tags(s)

MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQ
VDFQEYAVFLALITVMCNDFFQGCPDRP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005978
ORF Size 294 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005978.4
RefSeq Size 970 bp
RefSeq ORF 297 bp
Locus ID 6273
UniProt ID P29034
Cytogenetics 1q21.3
MW 11.1 kDa
Summary The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:S100 alpha 2 (S100A2) (NM_005978) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201203L1 Lenti ORF clone of Human S100 calcium binding protein A2 (S100A2), Myc-DDK-tagged 10 ug
$450.00
RC201203L2 Lenti ORF clone of Human S100 calcium binding protein A2 (S100A2), mGFP tagged 10 ug
$450.00
RC201203L3 Lenti ORF clone of Human S100 calcium binding protein A2 (S100A2), Myc-DDK-tagged 10 ug
$450.00
RC201203L4 Lenti ORF clone of Human S100 calcium binding protein A2 (S100A2), mGFP tagged 10 ug
$450.00
RG201203 S100A2 (tGFP-tagged) - Human S100 calcium binding protein A2 (S100A2) 10 ug
$489.00
SC121135 S100A2 (untagged)-Human S100 calcium binding protein A2 (S100A2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.