RFC2 (NM_002914) Human Tagged ORF Clone

SKU
RC201138
RFC2 (Myc-DDK-tagged)-Human replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RFC2
Synonyms RFC40
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201138 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTGGAGGCCGTCTGTGGTGGCGCGGGCGAGGTGGAGGCCCAGGACTCTGACCCTGCCCCTGCCT
TCAGCAAGGCCCCCGGCAGCGCCGGCCACTACGAACTGCCGTGGGTTGAAAAATATAGGCCAGTAAAGCT
GAATGAAATTGTCGGGAATGAAGACACCGTGAGCAGGCTAGAGGTCTTTGCAAGGGAAGGAAATGTGCCC
AACATCATCATTGCGGGCCCTCCAGGAACCGGCAAGACCACAAGCATTCTGTGCTTGGCCCGGGCCCTGC
TGGGCCCAGCACTCAAAGATGCCATGTTGGAACTCAATGCTTCAAATGACAGCATGACCGACGGAGCCCA
GCAAGCCTTGAGGAGAACCATGGAAATCTACTCTAAAACCACTCGCTTCGCCCTTGCTTGTAATGCTTCG
GATAAGATCATCGAGCCCATTCAGTCCCGCTGTGCAGTCCTCCGGTACACAAAGCTGACCGACGCCCAGA
TCCTCACCAGGCTGATGAATGTTATCGAGAAGGAGAGGGTACCCTACACTGATGACGGCCTAGAAGCCAT
CATCTTCACGGCCCAGGGAGACATGAGGCAGGCGCTGAACAACCTGCAGTCCACCTTCTCAGGATTTGGC
TTCATTAACAGTGAGAACGTGTTCAAGGTCTGTGACGAGCCCCACCCACTGCTGGTAAAGGAGATGATCC
AGCACTGTGTGAATGCCAACATTGACGAAGCCTACAAGATTCTTGCTCACTTGTGGCATCTGGGCTACTC
ACCAGAAGATATCATTGGCAACATCTTTCGAGTGTGTAAAACTTTCCAAATGGCAGAATACCTGAAACTG
GAGTTTATCAAGGAAATTGGATACACTCACATGAAAATAGCGGAAGGAGTGAACTCTCTTTTGCAGATGG
CAGGCCTCCTGGCAAGGCTGTGTCAGAAGACAATGGCCCCGGTGGCCAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201138 protein sequence
Red=Cloning site Green=Tags(s)

MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVP
NIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDSMTDGAQQALRRTMEIYSKTTRFALACNAS
DKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFG
FINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKL
EFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVAS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002914
ORF Size 960 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002914.4
RefSeq Size 1657 bp
RefSeq ORF 963 bp
Locus ID 5982
UniProt ID P35250
Cytogenetics 7q11.23
Domains AAA
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways DNA replication, Mismatch repair, Nucleotide excision repair
MW 35.2 kDa
Summary This gene encodes a member of the activator 1 small subunits family. The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). Replication factor C, also called activator 1, is a protein complex consisting of five distinct subunits. This gene encodes the 40 kD subunit, which has been shown to be responsible for binding ATP and may help promote cell survival. Disruption of this gene is associated with Williams syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene of this gene has been defined on chromosome 2. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:RFC2 (NM_002914) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201138L3 Lenti ORF clone of Human replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC201138L4 Lenti ORF clone of Human replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 2, mGFP tagged 10 ug
$600.00
RG201138 RFC2 (tGFP-tagged) - Human replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118345 RFC2 (untagged)-Human replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.