CDC42EP3 (NM_006449) Human Tagged ORF Clone

SKU
RC201069
CDC42EP3 (Myc-DDK-tagged)-Human CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CDC42EP3
Synonyms BORG2; CEP3; UB1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201069 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGCCAAGACCCCAATTTACCTGAAAGCAGCCAATAACAAGAAAGGAAAGAAATTTAAACTGAGGG
ACATTCTGTCTCCTGATATGATCAGTCCCCCGCTTGGAGACTTTCGCCACACCATCCACATTGGCAAAGA
GGGCCAGCACGATGTCTTTGGAGATATTTCCTTTCTTCAAGGGAACTACGAGCTTTTACCTGGAAACCAG
GAGAAAGCACACCTGGGCCAGTTCCCTGGGCATAATGAGTTCTTCCGGGCCAACAGCACCTCGGACTCTG
TGTTCACAGAAACGCCCTCCCCGGTGCTCAAAAATGCCATCTCCCTCCCGACCATTGGAGGATCCCAAGC
TCTCATGTTGCCCTTATTGTCACCAGTGACATTTAATTCCAAACAGGAGTCCTTCGGGCCAGCAAAGCTG
CCCAGGCTTAGCTGCGAGCCCGTCATGGAGGAAAAAGCTCAGGAGAAAAGCAGTCTGTTGGAGAATGGGA
CAGTCCACCAGGGAGACACCTCGTGGGGCTCCAGCGGTTCTGCATCTCAGTCCAGCCAAGGCAGAGACAG
CCACTCCTCCAGCCTGTCCGAACAGTACCCCGACTGGCCAGCCGAGGACATGTTTGACCATCCCACCCCA
TGCGAGCTCATCAAGGGAAAGACTAAGTCAGAGGAGTCCCTCTCTGACCTTACAGGTTCCCTCCTCTCCC
TGCAGCTTGATCTTGGGCCCTCACTTTTGGATGAGGTGCTGAATGTAATGGATAAAAATAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201069 protein sequence
Red=Cloning site Green=Tags(s)

MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQ
EKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKL
PRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTP
CELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006449
ORF Size 762 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006449.5
RefSeq Size 5715 bp
RefSeq ORF 765 bp
Locus ID 10602
UniProt ID Q9UKI2
Cytogenetics 2p22.2
Domains PBD
MW 27.7 kDa
Summary This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
Write Your Own Review
You're reviewing:CDC42EP3 (NM_006449) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201069L1 Lenti ORF clone of Human CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3), Myc-DDK-tagged 10 ug
$600.00
RC201069L2 Lenti ORF clone of Human CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3), mGFP tagged 10 ug
$600.00
RC201069L3 Lenti ORF clone of Human CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3), Myc-DDK-tagged 10 ug
$600.00
RC201069L4 Lenti ORF clone of Human CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3), mGFP tagged 10 ug
$600.00
RG201069 CDC42EP3 (tGFP-tagged) - Human CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116073 CDC42EP3 (untagged)-Human CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3) 10 ug
$300.00
SC320340 CDC42EP3 (untagged)-Human CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.