CENPM (NM_024053) Human Tagged ORF Clone

SKU
RC201047
CENPM (Myc-DDK-tagged)-Human centromere protein M (CENPM), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CENPM
Synonyms C22orf18; CENP-M; PANE1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201047 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGTGTTGAGGCCCCTGGACAAGCTGCCCGGCCTGAACACGGCCACCATCTTGCTGGTGGGCACGG
AGGATGCTCTTCTGCAGCAGCTGGCGGACTCGATGCTCAAAGAGGACTGCGCCTCCGAGCTGAAGGTCCA
CTTGGCAAAGTCCCTCCCTTTGCCCTCCAGTGTGAATCGGCCCCGAATTGACCTGATCGTGTTTGTGGTT
AATCTTCACAGCAAATACAGTCTCCAGAACACAGAGGAGTCCCTGCGCCATGTGGATGCCAGCTTCTTCT
TGGGGAAGGTGTGTTTCCTCGCCACAGGTGCTGGGCGGGAGAGCCACTGCAGCATTCACCGGCACACCGT
GGTGAAGCTGGCCCACACCTATCAAAGCCCCCTGCTCTACTGTGACCTGGAGGTGGAAGGCTTTAGGGCC
ACCATGGCGCAGCGCCTGGTGCGCGTGCTGCAGATCTGTGCTGGCCACGTGCCCGGTGTCTCAGCTCTGA
ACCTGCTGTCCCTGCTGAGAAGCTCTGAGGGCCCCTCCCTGGAGGACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201047 protein sequence
Red=Cloning site Green=Tags(s)

MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVV
NLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEGFRA
TMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024053
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024053.5
RefSeq Size 947 bp
RefSeq ORF 543 bp
Locus ID 79019
UniProt ID Q9NSP4
Cytogenetics 22q13.2
Protein Families Druggable Genome
MW 19.7 kDa
Summary The protein encoded by this gene is an inner protein of the kinetochore, the multi-protein complex that binds spindle microtubules to regulate chromosome segregation during cell division. It belongs to the constitutive centromere-associated network protein group, whose members interact with outer kinetochore proteins and help to maintain centromere identity at each cell division cycle. The protein is structurally related to GTPases but cannot bind guanosine triphosphate. A point mutation that affects interaction with another constitutive centromere-associated network protein, CENP-I, impairs kinetochore assembly and chromosome alignment, suggesting that it is required for kinetochore formation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]
Write Your Own Review
You're reviewing:CENPM (NM_024053) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201047L1 Lenti ORF clone of Human centromere protein M (CENPM), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201047L2 Lenti ORF clone of Human centromere protein M (CENPM), transcript variant 1, mGFP tagged 10 ug
$600.00
RC201047L3 Lenti ORF clone of Human centromere protein M (CENPM), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201047L4 Lenti ORF clone of Human centromere protein M (CENPM), transcript variant 1, mGFP tagged 10 ug
$600.00
RG201047 CENPM (tGFP-tagged) - Human centromere protein M (CENPM), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC122946 CENPM (untagged)-Human centromere protein M (CENPM), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.