Methionine Sulfoxide Reductase B (MSRB1) (NM_016332) Human Tagged ORF Clone

SKU
RC201020
MSRB1 (Myc-DDK-tagged)-Human selenoprotein X, 1 (SEPX1), (Note, selenocysteine protein, internal stop codon, see reference data summary)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$118.00
In Stock*
Specifications
Product Data
Type Human Untagged ORF Clone
Target Symbol Methionine Sulfoxide Reductase B
Synonyms HSPC270; SELENOR; SELENOX; SELR; SELX; SepR; SEPX1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201020 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTTCTGCAGCTTCTTCGGGGGCGAGGTTTTCCAGAATCACTTTGAACCTGGCGTTTACGTGTGTG
CCAAGTGTGGCTATGAGCTGTTCTCCAGCCGCTCGAAGTATGCACACTCGTCTCCATGGCCGGCGTTCAC
CGAGACCATTCACGCCGACAGCGTGGCCAAGCGTCCGGAGCACAATAGATCTGAAGCCTTGAAGGTGTCC
TGTGGCAAGTGTGGCAATGGGTTGGGCCACGAGTTCCTGAACGACGGCCCCAAGCCGGGGCAGTCCCGAT
TCTGAATATTCAGCAGCTCGCTGAAGTTTGTCCCTAAAGGCAAAGAAACTTCTGCCTCCCAGGGTCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201020 protein sequence
Red=Cloning site Green=Tags(s)

MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVS
CGKCGNGLGHEFLNDGPKPGQSRF*IFSSSLKFVPKGKETSASQGH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016332
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
OTI Annotation This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016332.4
RefSeq Size 1386 bp
RefSeq ORF 351 bp
Locus ID 51734
UniProt ID Q9NZV6
Cytogenetics 16p13.3
Domains SelR
Summary The protein encoded by this gene belongs to the methionine-R-sulfoxide reductase B (MsrB) family. Members of this family function as repair enzymes that protect proteins from oxidative stress by catalyzing the reduction of methionine-R-sulfoxides to methionines. This protein is highly expressed in liver and kidney, and is localized to the nucleus and cytosol. It is the only member of the MsrB family that is a selenoprotein, containing a selenocysteine (Sec) residue at its active site. It also has the highest methionine-R-sulfoxide reductase activity compared to other members containing cysteine in place of Sec. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. A pseudogene of this locus has been identified on chromosome 19. [provided by RefSeq, Aug 2017]
Write Your Own Review
You're reviewing:Methionine Sulfoxide Reductase B (MSRB1) (NM_016332) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RG201020 MSRB1 (GFP-tagged) - Human selenoprotein X, 1 (SEPX1), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$489.00
SC114321 MSRB1 (untagged)-Human selenoprotein X, 1 (SEPX1) (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$429.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.