AKIRIN2 (NM_018064) Human Tagged ORF Clone

SKU
RC200881
AKIRIN2 (Myc-DDK-tagged)-Human akirin 2 (AKIRIN2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
5 Days*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol AKIRIN2
Synonyms C6orf166; dJ486L4.2; FBI1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200881 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTGCGGAGCCACTCTGAAAAGGACTCTGGATTTCGACCCGCTGTTGAGCCCGGCGTCCCCGAAGC
GCAGGCGATGTGCGCCATTGTCGGCGCCCACCTCGGCCGCTGCCTCCCCGTTGTCGGCGGCCGCGGCCAC
CGCCGCCTCCTTCTCCGCTGCGGCCGCCTCGCCGCAGAAGTATCTCCGAATGGAGCCATCCCCCTTCGGC
GACGTCTCCTCCCGCCTCACCACAGAACAAATTCTGTACAACATAAAACAAGAGTATAAACGAATGCAGA
AGAGAAGACATTTAGAAACGAGTTTCCAACAGACAGATCCGTGTTGTACTTCTGATGCACAGCCACATGC
ATTTCTCCTCAGTGGACCAGCTTCACCAGGGACTTCATCTGCAGCATCCTCACCATTAAAAAAAGAACAG
CCCTTATTTACTCTACGGCAGGTTGGGATGATCTGTGAACGTTTGTTGAAAGAACGTGAAGAGAAAGTTC
GAGAAGAATATGAAGAAATATTGAACACAAAACTTGCAGAACAATATGATGCGTTTGTGAAGTTTACGCA
TGATCAAATAATGCGACGATATGGAGAACAGCCTGCTAGCTATGTTTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200881 protein sequence
Red=Cloning site Green=Tags(s)

MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFG
DVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQ
PLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018064
ORF Size 609 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018064.4
RefSeq Size 1948 bp
RefSeq ORF 612 bp
Locus ID 55122
UniProt ID Q53H80
Cytogenetics 6q15
MW 22.5 kDa
Summary Required for the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1 beta signaling pathways leading to the production of IL-6. Forms a complex with YWHAB that acts to repress transcription of DUSP1 (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:AKIRIN2 (NM_018064) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200881L1 Lenti ORF clone of Human akirin 2 (AKIRIN2), Myc-DDK-tagged 10 ug
$600.00
RC200881L2 Lenti ORF clone of Human akirin 2 (AKIRIN2), mGFP tagged 10 ug
$600.00
RC200881L3 Lenti ORF clone of Human akirin 2 (AKIRIN2), Myc-DDK-tagged 10 ug
$600.00
RC200881L4 Lenti ORF clone of Human akirin 2 (AKIRIN2), mGFP tagged 10 ug
$600.00
RG200881 AKIRIN2 (tGFP-tagged) - Human akirin 2 (AKIRIN2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC108391 AKIRIN2 (untagged)-Human akirin 2 (AKIRIN2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.