FLIP (CFLAR) (NM_003879) Human Tagged ORF Clone

CAT#: RC200608

Reviews ()
Write a review

CFLAR (Myc-DDK-tagged)-Human CASP8 and FADD-like apoptosis regulator (CFLAR), transcript variant 1



  "NM_003879" in other vectors (6)

Reconstitution Protocol

USD 686.00

USD 1,029.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "CFLAR"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CFLAR
Synonyms c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; cFLIP; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200608 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGCTGAAGTCATCCATCAGGTTGAAGAAGCACTTGATACAGATGAGAAGGAGATGCTGCTCTTTT
TGTGCCGGGATGTTGCTATAGATGTGGTTCCACCTAATGTCAGGGACCTTCTGGATATTTTACGGGAAAG
AGGTAAGCTGTCTGTCGGGGACTTGGCTGAACTGCTCTACAGAGTGAGGCGATTTGACCTGCTCAAACGT
ATCTTGAAGATGGACAGAAAAGCTGTGGAGACCCACCTGCTCAGGAACCCTCACCTTGTTTCGGACTATA
GAGTGCTGATGGCAGAGATTGGTGAGGATTTGGATAAATCTGATGTGTCCTCATTAATTTTCCTCATGAA
GGATTACATGGGCCGAGGCAAGATAAGCAAGGAGAAGAGTTTCTTGGACCTTGTGGTTGAGTTGGAGAAA
CTAAATCTGGTTGCCCCAGATCAACTGGATTTATTAGAAAAATGCCTAAAGAACATCCACAGAATAGACC
TGAAGACAAAAATCCAGAAGTACAAGCAGTCTGTTCAAGGAGCAGGGACAAGTTACAGGAATGTTCTCCA
AGCAGCAATCCAAAAGAGTCTCAAGGATCCTTCAAATAACTTCAGGCTCCATAATGGGAGAAGTAAAGAA
CAAAGACTTAAGGAACAGCTTGGCGCTCAACAAGAACCAGTGAAGAAATCCATTCAGGAATCAGAAGCTT
TTTTGCCTCAGAGCATACCTGAAGAGAGATACAAGATGAAGAGCAAGCCCCTAGGAATCTGCCTGATAAT
CGATTGCATTGGCAATGAGACAGAGCTTCTTCGAGACACCTTCACTTCCCTGGGCTATGAAGTCCAGAAA
TTCTTGCATCTCAGTATGCATGGTATATCCCAGATTCTTGGCCAATTTGCCTGTATGCCCGAGCACCGAG
ACTACGACAGCTTTGTGTGTGTCCTGGTGAGCCGAGGAGGCTCCCAGAGTGTGTATGGTGTGGATCAGAC
TCACTCAGGGCTCCCCCTGCATCACATCAGGAGGATGTTCATGGGAGATTCATGCCCTTATCTAGCAGGG
AAGCCAAAGATGTTTTTTATTCAGAACTATGTGGTGTCAGAGGGCCAGCTGGAGGACAGCAGCCTCTTGG
AGGTGGATGGGCCAGCGATGAAGAATGTGGAATTCAAGGCTCAGAAGCGAGGGCTGTGCACAGTTCACCG
AGAAGCTGACTTCTTCTGGAGCCTGTGTACTGCGGACATGTCCCTGCTGGAGCAGTCTCACAGCTCACCA
TCCCTGTACCTGCAGTGCCTCTCCCAGAAACTGAGACAAGAAAGAAAACGCCCACTCCTGGATCTTCACA
TTGAACTCAATGGCTACATGTATGATTGGAACAGCAGAGTTTCTGCCAAGGAGAAATATTATGTCTGGCT
GCAGCACACTCTGAGAAAGAAACTTATCCTCTCCTACACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200608 protein sequence
Red=Cloning site Green=Tags(s)

MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKR
ILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEK
LNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKE
QRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQK
FLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAG
KPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP
SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003879
ORF Size 1440 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003879.7
RefSeq Size 10640 bp
RefSeq ORF 1443 bp
Locus ID 8837
UniProt ID O15519
Cytogenetics 2q33.1
Domains DED, CASc, ICE_p20
Protein Families Druggable Genome, Protease
Protein Pathways Apoptosis
MW 55.3 kDa
Gene Summary The protein encoded by this gene is a regulator of apoptosis and is structurally similar to caspase-8. However, the encoded protein lacks caspase activity and appears to be itself cleaved into two peptides by caspase-8. Several transcript variants encoding different isoforms have been found for this gene, and partial evidence for several more variants exists. [provided by RefSeq, Feb 2011]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.