HOXA9 (NM_152739) Human Tagged ORF Clone

SKU
RC200559
HOXA9 (Myc-DDK-tagged)-Human homeobox A9 (HOXA9)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$480.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HOXA9
Synonyms ABD-B; HOX1; HOX1.7; HOX1G
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200559 representing NM_152739.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGCCACCACTGGGGCCCTGGGCAACTACTACGTGGACTCGTTCCTGCTGGGCGCCGACGCCGCGGATG
AGCTGAGCGTTGGCCGCTATGCGCCGGGGACCCTGGGCCAGCCTCCCCGGCAGGCGGCGACGCTGGCCGA
GCACCCCGACTTCAGCCCGTGCAGCTTCCAGTCCAAGGCGACGGTGTTTGGCGCCTCGTGGAACCCAGTG
CACGCGGCGGGCGCCAACGCTGTACCCGCTGCGGTGTACCACCACCATCACCACCACCCCTACGTGCACC
CCCAGGCGCCCGTGGCGGCGGCGGCGCCGGACGGCAGGTACATGCGCTCCTGGCTGGAGCCCACGCCCGG
TGCGCTCTCCTTCGCGGGCTTGCCCTCCAGCCGGCCTTATGGCATTAAACCTGAACCGCTGTCGGCCAGA
AGGGGTGACTGTCCCACGCTTGACACTCACACTTTGTCCCTGACTGACTATGCTTGTGGTTCTCCTCCAG
TTGATAGAGAAAAACAACCCAGCGAAGGCGCCTTCTCTGAAAACAATGCTGAGAATGAGAGCGGCGGAGA
CAAGCCCCCCATCGATCCCAATAACCCAGCAGCCAACTGGCTTCATGCGCGCTCCACTCGGAAAAAGCGG
TGCCCCTATACAAAACACCAGACCCTGGAACTGGAGAAAGAGTTTCTGTTCAACATGTACCTCACCAGGG
ACCGCAGGTACGAGGTGGCTCGACTGCTCAACCTCACCGAGAGGCAGGTCAAGATCTGGTTCCAGAACCG
CAGGATGAAAATGAAGAAAATCAACAAAGACCGAGCAAAAGACGAGTGA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by RC200559
Blue=ORF Red=Cloning site Green=Tag(s)

MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKATVFGASWNPV
HAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSAR
RGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKR
CPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE

myc-FLAG tag

Recombinant protein using RC200559 also available,TP300559
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152739
ORF Size 816 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152739.4
RefSeq Size 2076 bp
RefSeq ORF 819 bp
Locus ID 3205
UniProt ID P31269
Cytogenetics 7p15.2
MW 30 kDa
Summary In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Read-through transcription exists between this gene and the upstream homeobox A10 (HOXA10) gene.[provided by RefSeq, Mar 2011]
Write Your Own Review
You're reviewing:HOXA9 (NM_152739) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200559L1 Lenti-ORF clone of HOXA9 (Myc-DDK-tagged)-Human homeobox A9 (HOXA9) 10 ug
$780.00
RC200559L2 Lenti-ORF clone of HOXA9 (mGFP-tagged)-Human homeobox A9 (HOXA9) 10 ug
$780.00
RC200559L3 Lenti-ORF clone of HOXA9 (Myc-DDK-tagged)-Human homeobox A9 (HOXA9) 10 ug
$780.00
RC200559L4 Lenti-ORF clone of HOXA9 (mGFP-tagged)-Human homeobox A9 (HOXA9) 10 ug
$780.00
RG200559 HOXA9 (tGFP-tagged) - Human homeobox A9 (HOXA9) 10 ug
$680.00
SC321224 HOXA9 (untagged)-Human homeobox A9 (HOXA9) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.