MSK1 (RPS6KA5) (NM_182398) Human Tagged ORF Clone

SKU
RC200549
RPS6KA5 (Myc-DDK-tagged)-Human ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$511.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MSK1
Synonyms MSK1; MSPK1; RLPK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200549 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGGAGGGTGGCAGCAGCGGCGGCGCCGCGGGGACCAGCGCGGACGGCGGCGACGGAGGAGAGC
AGCTCCTCACTGTCAAGCACGAGCTGCGGACTGCTAATTTGACAGGACATGCTGAGAAGGTGGGAATAGA
AAATTTTGAGCTCCTGAAGGTCCTAGGAACTGGAGCTTATGGAAAAGTATTTCTAGTTCGTAAAATAAGT
GGCCATGATACTGGAAAGCTGTATGCCATGAAAGTTTTGAAAAAGGCAACAATCGTTCAAAAGGCCAAAA
CCACAGAGCATACAAGGACAGAACGACAAGTCCTGGAACACATTAGGCAGTCGCCATTTTTGGTAACATT
ACATTATGCTTTCCAGACAGAAACCAAACTTCATCTCATTTTAGATTATATAAATGGTGGTGAACTTTTT
ACTCATCTTTCTCAAAGAGAGCGTTTCACAGAGCATGAGGTGCAGATTTATGTTGGAGAGATTGTGCTTG
CCCTCGAACATCTCCACAAGTTGGGGATTATATATCGTGATATTAAGCTTGAGAATATTCTACTTGATTC
TAATGGCCATGTGGTGCTGACAGATTTTGGTCTGAGTAAGGAGTTTGTGGCTGATGAAACTGAAAGAGCA
TATTCCTTTTGTGGAACTATTGAATACATGGCACCAGATATTGTCAGAGGGGGAGATTCAGGACATGACA
AGGCAGTTGACTGGTGGAGTTTGGGTGTTCTAATGTATGAATTACTAACTGGAGCATCTCCTTTCACTGT
TGATGGAGAAAAAAATTCCCAAGCTGAGATATCTAGGAGAATATTAAAAAGTGAGCCTCCATATCCCCAA
GAAATGAGTGCTTTAGCGAAAGACCTAATTCAGCGTCTTTTGATGAAAGATCCCAAGAAGAGATTGGGAT
GTGGTCCACGTGATGCAGATGAAATCAAAGAACATCTCTTCTTTCAGAAAATAAATTGGGATGATTTAGC
CGCCAAAAAAGTGCCTGCACCATTTAAGCCAGTCATTCGAGATGAATTAGATGTGAGTAACTTTGCAGAA
GAGTTCACAGAAATGGATCCCACTTATTCTCCCGCAGCCCTGCCCCAGAGTTCTGAGAAGCTGTTTCAGG
GCTATTCCTTTGTTGCTCCTTCCATCCTATTCAAGCGTAATGCAGCTGTCATAGACCCTCTTCAGTTTCA
CATGGGAGTTGAACGTCCTGGAGTGACAAATGTTGCCAGGAGTGCAATGATGAAGGACTCTCCATTCTAT
CAACACTATGACCTAGATTTGAAGGACAAACCCCTGGGAGAAGGTAGTTTTTCAATTTGTCGAAAGTGTG
TGCATAAAAAAAGTAACCAAGCTTTTGCAGTCAAAATAATCAGCAAAAGGATGGAAGCCAATACTCAAAA
GGAAATAACAGCTCTGAAACTCTGTGAAGGACACCCCAATATTGTGAAGTTGCATGAAGTTTTTCATGAT
CAGCTTCACACGTTTCTAGTGATGGAACTTCTGAATGGAGGAGAACTGTTTGAGCGCATTAAGAAAAAGA
AGCACTTCAGTGAGACGGAAGCCAGCTACATCATGAGGAAGCTTGTTTCAGCTGTAAGCCACATGCATGA
TGTTGGAGTGGTGCACAGGGATCTGAAACCTGAGGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200549 protein sequence
Red=Cloning site Green=Tags(s)

MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKIS
GHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELF
THLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVADETERA
YSFCGTIEYMAPDIVRGGDSGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQ
EMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAE
EFTEMDPTYSPAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHD
QLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGVVHRDLKPEV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_182398
ORF Size 1647 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_182398.2
RefSeq Size 2343 bp
RefSeq ORF 1650 bp
Locus ID 9252
UniProt ID O75582
Cytogenetics 14q32.11
Protein Families Druggable Genome, Protein Kinase, Transcription Factors
Protein Pathways Bladder cancer, MAPK signaling pathway, Neurotrophin signaling pathway
MW 61.8 kDa
Summary Serine/threonine-protein kinase that is required for the mitogen or stress-induced phosphorylation of the transcription factors CREB1 and ATF1 and for the regulation of the transcription factors RELA, STAT3 and ETV1/ER81, and that contributes to gene activation by histone phosphorylation and functions in the regulation of inflammatory genes (PubMed:11909979, PubMed:12569367, PubMed:12763138, PubMed:9687510, PubMed:18511904, PubMed:9873047). Phosphorylates CREB1 and ATF1 in response to mitogenic or stress stimuli such as UV-C irradiation, epidermal growth factor (EGF) and anisomycin (PubMed:11909979, PubMed:9873047). Plays an essential role in the control of RELA transcriptional activity in response to TNF and upon glucocorticoid, associates in the cytoplasm with the glucocorticoid receptor NR3C1 and contributes to RELA inhibition and repression of inflammatory gene expression (PubMed:12628924, PubMed:18511904). In skeletal myoblasts is required for phosphorylation of RELA at 'Ser-276' during oxidative stress (PubMed:12628924). In erythropoietin-stimulated cells, is necessary for the 'Ser-727' phosphorylation of STAT3 and regulation of its transcriptional potential (PubMed:12763138). Phosphorylates ETV1/ER81 at 'Ser-191' and 'Ser-216', and thereby regulates its ability to stimulate transcription, which may be important during development and breast tumor formation (PubMed:12569367). Directly represses transcription via phosphorylation of 'Ser-1' of histone H2A (PubMed:15010469). Phosphorylates 'Ser-10' of histone H3 in response to mitogenics, stress stimuli and EGF, which results in the transcriptional activation of several immediate early genes, including proto-oncogenes c-fos/FOS and c-jun/JUN (PubMed:12773393). May also phosphorylate 'Ser-28' of histone H3 (PubMed:12773393). Mediates the mitogen- and stress-induced phosphorylation of high mobility group protein 1 (HMGN1/HMG14) (PubMed:12773393). In lipopolysaccharide-stimulated primary macrophages, acts downstream of the Toll-like receptor TLR4 to limit the production of pro-inflammatory cytokines (By similarity). Functions probably by inducing transcription of the MAP kinase phosphatase DUSP1 and the anti-inflammatory cytokine interleukin 10 (IL10), via CREB1 and ATF1 transcription factors (By similarity). Plays a role in neuronal cell death by mediating the downstream effects of excitotoxic injury (By similarity). Phosphorylates TRIM7 at 'Ser-107' in response to growth factor signaling via the MEK/ERK pathway, thereby stimulating its ubiquitin ligase activity (PubMed:25851810).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MSK1 (RPS6KA5) (NM_182398) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200549L1 Lenti ORF clone of Human ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 2, Myc-DDK-tagged 10 ug
$811.00
RC200549L2 Lenti ORF clone of Human ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 2, mGFP tagged 10 ug
$811.00
RC200549L3 Lenti ORF clone of Human ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 2, Myc-DDK-tagged 10 ug
$811.00
RC200549L4 Lenti ORF clone of Human ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 2, mGFP tagged 10 ug
$811.00
RG200549 RPS6KA5 (tGFP-tagged) - Human ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 2 10 ug
$489.00 MSRP $711.00 MSRP $711.00
SC128215 RPS6KA5 (untagged)-Human ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 2 10 ug
$512.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.