Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Tagged ORF Clone

SKU
RC200482
CSNK1D (Myc-DDK-tagged)-Human casein kinase 1, delta (CSNK1D), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Casein Kinase 1 delta
Synonyms ASPS; CKI-delta; CKId; CKIdelta; FASPS2; HCKID
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200482 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGAGAGTCGGGAACAGGTACCGGCTGGGCCGGAAGATCGGCAGCGGCTCCTTCGGAGACATCT
ATCTCGGTACGGACATTGCTGCAGGAGAAGAGGTTGCCATCAAGCTTGAATGTGTCAAAACCAAACACCC
TCAGCTCCACATTGAGAGCAAAATCTACAAGATGATGCAGGGAGGAGTGGGCATCCCCACCATCAGATGG
TGCGGGGCAGAGGGGGACTACAACGTCATGGTGATGGAGCTGCTGGGGCCAAGCCTGGAGGACCTCTTCA
ACTTCTGCTCCAGGAAATTCAGCCTCAAAACCGTCCTGCTGCTTGCTGACCAAATGATCAGTCGCATCGA
ATACATTCATTCAAAGAACTTCATCCACCGGGATGTGAAGCCAGACAACTTCCTCATGGGCCTGGGGAAG
AAGGGCAACCTGGTGTACATCATCGACTTCGGGCTGGCCAAGAAGTACCGGGATGCACGCACCCACCAGC
ACATCCCCTATCGTGAGAACAAGAACCTCACGGGGACGGCGCGGTACGCCTCCATCAACACGCACCTTGG
AATTGAACAATCCCGAAGAGATGACTTGGAGTCTCTGGGCTACGTGCTAATGTACTTCAACCTGGGCTCT
CTCCCCTGGCAGGGGCTGAAGGCTGCCACCAAGAGACAGAAATACGAAAGGATTAGCGAGAAGAAAATGT
CCACCCCCATCGAAGTGTTGTGTAAAGGCTACCCTTCCGAATTTGCCACATACCTGAATTTCTGCCGTTC
CTTGCGTTTTGACGACAAGCCTGACTACTCGTACCTGCGGCAGCTTTTCCGGAATCTGTTCCATCGCCAG
GGCTTCTCCTATGACTACGTGTTCGACTGGAACATGCTCAAATTTGGTGCCAGCCGGGCCGCCGATGACG
CCGAGCGGGAGCGCAGGGACCGAGAGGAGCGGCTGAGACACTCGCGGAACCCGGCTACCCGCGGCCTCCC
TTCCACAGCCTCCGGCCGCCTGCGGGGGACGCAGGAAGTGGCTCCCCCCACACCCCTCACCCCTACCTCA
CACACGGCTAACACCTCCCCCCGGCCTGTCTCCGGCATGGAGAGAGAGCGGAAAGTGAGTATGCGGCTGC
ACCGCGGGGCCCCCGTCAACATCTCCTCGTCCGACCTCACAGGCCGACAAGATACCTCTCGCATGTCCAC
CTCACAGATTCCTGGTCGGGTGGCTTCCAGTGGTCTTCAGTCTGTCGTGCACCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200482 protein sequence
Red=Cloning site Green=Tags(s)

MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIRW
CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK
KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS
LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ
GFSYDYVFDWNMLKFGASRAADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTS
HTANTSPRPVSGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001893
ORF Size 1245 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001893.2
RefSeq Size 3714 bp
RefSeq ORF 1248 bp
Locus ID 1453
UniProt ID P48730
Cytogenetics 17q25.3
Domains pkinase, S_TKc, TyrKc
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Circadian rhythm - mammal, Gap junction, Hedgehog signaling pathway
MW 47.3 kDa
Summary This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein may also be involved in the regulation of apoptosis, circadian rhythm, microtubule dynamics, chromosome segregation, and p53-mediated effects on growth. The encoded protein is highly similar to the mouse and rat CK1 delta homologs. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2014]
Write Your Own Review
You're reviewing:Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200482L1 Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC200482L2 Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 1, mGFP tagged 10 ug
$986.00
RC200482L3 Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC200482L4 Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 1, mGFP tagged 10 ug
$986.00
RG200482 CSNK1D (tGFP-tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 1 10 ug
$886.00
SC319469 CSNK1D (untagged)-Human casein kinase 1, delta (CSNK1D), transcript variant 1 10 ug
$686.00
SC323472 CSNK1D (untagged)-Kinase deficient mutant (K38M) of Human casein kinase 1, delta (CSNK1D), transcript variant 1 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.