Rab2 (RAB2A) (NM_002865) Human Tagged ORF Clone

SKU
RC200433
RAB2A (Myc-DDK-tagged)-Human RAB2A, member RAS oncogene family (RAB2A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Rab2
Synonyms LHX; RAB2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200433 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTACGCCTATCTCTTCAAGTACATCATAATCGGCGACACAGGTGTTGGTAAATCATGCTTATTGC
TACAGTTTACAGACAAGAGGTTTCAGCCAGTGCATGACCTTACTATTGGTGTAGAGTTCGGTGCTCGAAT
GATAACTATTGATGGGAAACAGATAAAACTTCAGATATGGGATACGGCAGGGCAAGAATCCTTTCGTTCC
ATCACAAGGTCGTATTACAGAGGTGCAGCAGGAGCTTTACTAGTTTACGATATTACACGGAGAGATACAT
TCAACCACTTGACAACCTGGTTAGAAGATGCCCGCCAGCATTCCAATTCCAACATGGTCATTATGCTTAT
TGGAAATAAAAGTGATTTAGAATCTAGAAGAGAAGTAAAAAAAGAAGAAGGTGAAGCTTTTGCACGAGAA
CATGGACTCATCTTCATGGAAACGTCTGCTAAGACTGCTTCCAATGTAGAAGAGGCATTTATTAATACAG
CAAAAGAAATTTATGAAAAAATTCAAGAAGGAGTCTTTGACATTAATAATGAGGCAAATGGCATTAAAAT
TGGCCCTCAGCATGCTGCTACCAATGCAACACATGCAGGCAATCAGGGAGGACAGCAGGCTGGGGGCGGC
TGCTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200433 protein sequence
Red=Cloning site Green=Tags(s)

MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRS
ITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFARE
HGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGG
CC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002865
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002865.3
RefSeq Size 3812 bp
RefSeq ORF 639 bp
Locus ID 5862
UniProt ID P61019
Cytogenetics 8q12.1-q12.2
Domains ras
Protein Families Druggable Genome
MW 23.5 kDa
Summary The protein encoded by this gene belongs to the Rab family, members of which are small molecular weight guanosine triphosphatases (GTPases) that contain highly conserved domains involved in GTP binding and hydrolysis. The Rabs are membrane-bound proteins, involved in vesicular fusion and trafficking. This protein is a resident of pre-Golgi intermediates, and is required for protein transport from the endoplasmic reticulum (ER) to the Golgi complex. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Write Your Own Review
You're reviewing:Rab2 (RAB2A) (NM_002865) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200433L1 Lenti ORF clone of Human RAB2A, member RAS oncogene family (RAB2A), Myc-DDK-tagged 10 ug
$600.00
RC200433L2 Lenti ORF clone of Human RAB2A, member RAS oncogene family (RAB2A), mGFP tagged 10 ug
$600.00
RC200433L3 Lenti ORF clone of Human RAB2A, member RAS oncogene family (RAB2A), Myc-DDK-tagged 10 ug
$600.00
RC200433L4 Lenti ORF clone of Human RAB2A, member RAS oncogene family (RAB2A), mGFP tagged 10 ug
$600.00
RG200433 RAB2A (tGFP-tagged) - Human RAB2A, member RAS oncogene family (RAB2A) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118348 RAB2A (untagged)-Human RAB2A, member RAS oncogene family (RAB2A) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.