Chemerin (RARRES2) (NM_002889) Human Tagged ORF Clone

SKU
RC200383
RARRES2 (Myc-DDK-tagged)-Human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Chemerin
Synonyms HP10433; TIG2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200383 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGACGGCTGCTGATCCCTCTGGCCCTGTGGCTGGGCGCGGTGGGCGTGGGCGTCGCCGAGCTCACGG
AAGCCCAGCGCCGGGGCCTGCAGGTGGCCCTGGAGGAATTTCACAAGCACCCGCCCGTGCAGTGGGCCTT
CCAGGAGACCAGTGTGGAGAGCGCCGTGGACACGCCCTTCCCAGCTGGAATATTTGTGAGGCTGGAATTT
AAGCTGCAGCAGACAAGCTGCCGGAAGAGGGACTGGAAGAAACCCGAGTGCAAAGTCAGGCCCAATGGGA
GGAAACGGAAATGCCTGGCCTGCATCAAACTGGGCTCTGAGGACAAAGTTCTGGGCCGGTTGGTCCACTG
CCCCATAGAGACCCAAGTTCTGCGGGAGGCTGAGGAGCACCAGGAGACCCAGTGCCTCAGGGTGCAGCGG
GCTGGTGAGGACCCCCACAGCTTCTACTTCCCTGGACAGTTCGCCTTCTCCAAGGCCCTGCCCCGCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200383 protein sequence
Red=Cloning site Green=Tags(s)

MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF
KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR
AGEDPHSFYFPGQFAFSKALPRS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002889
ORF Size 489 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002889.4
RefSeq Size 767 bp
RefSeq ORF 492 bp
Locus ID 5919
UniProt ID Q99969
Cytogenetics 7q36.1
Protein Families Druggable Genome, Nuclear Hormone Receptor, Secreted Protein
MW 18.6 kDa
Summary This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi. [provided by RefSeq, Nov 2014]
Write Your Own Review
You're reviewing:Chemerin (RARRES2) (NM_002889) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200383L1 Lenti ORF clone of Human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2), Myc-DDK-tagged 10 ug
$450.00
RC200383L2 Lenti ORF clone of Human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2), mGFP tagged 10 ug
$450.00
RC200383L3 Lenti ORF clone of Human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2), Myc-DDK-tagged 10 ug
$450.00
RC200383L4 Lenti ORF clone of Human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2), mGFP tagged 10 ug
$450.00
RG200383 RARRES2 (tGFP-tagged) - Human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2) 10 ug
$489.00
SC118329 RARRES2 (untagged)-Human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.