RHOC (NM_001042679) Human Tagged ORF Clone

SKU
RC200332
RHOC (Myc-DDK-tagged)-Human ras homolog gene family, member C (RHOC), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RHOC
Synonyms ARH9; ARHC; H9; RHOH9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200332 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCAATCCGAAAGAAGCTGGTGATCGTTGGGGATGGTGCCTGTGGGAAGACCTGCCTCCTCATCG
TCTTCAGCAAGGATCAGTTTCCGGAGGTCTACGTCCCTACTGTCTTTGAGAACTATATTGCGGACATTGA
GGTGGACGGCAAGCAGGTGGAGCTGGCTCTGTGGGACACAGCAGGGCAGGAAGACTATGATCGACTGCGG
CCTCTCTCCTACCCGGACACTGATGTCATCCTCATGTGCTTCTCCATCGACAGCCCTGACAGCCTGGAAA
ACATTCCTGAGAAGTGGACCCCAGAGGTGAAGCACTTCTGCCCCAACGTGCCCATCATCCTGGTGGGGAA
TAAGAAGGACCTGAGGCAAGACGAGCACACCAGGAGAGAGCTGGCCAAGATGAAGCAGGAGCCCGTTCGG
TCTGAGGAAGGCCGGGACATGGCGAACCGGATCAGTGCCTTTGGCTACCTTGAGTGCTCAGCCAAGACCA
AGGAGGGAGTGCGGGAGGTGTTTGAGATGGCCACTCGGGCTGGCCTCCAGGTCCGCAAGAACAAGCGTCG
GAGGGGCTGTCCCATTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200332 protein sequence
Red=Cloning site Green=Tags(s)

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLR
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVR
SEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001042679
ORF Size 579 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001042679.1, NP_001036144.1
RefSeq Size 1313 bp
RefSeq ORF 582 bp
Locus ID 389
UniProt ID P08134
Cytogenetics 1p13.2
Protein Families Druggable Genome
MW 22 kDa
Summary This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RHOC (NM_001042679) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200332L3 Lenti ORF clone of Human ras homolog gene family, member C (RHOC), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC200332L4 Lenti ORF clone of Human ras homolog gene family, member C (RHOC), transcript variant 3, mGFP tagged 10 ug
$600.00
RG200332 RHOC (tGFP-tagged) - Human ras homolog gene family, member C (RHOC), transcript variant 3 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319336 RHOC (untagged)-Human ras homolog gene family, member C (RHOC), transcript variant 3 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.