ARPC2 (NM_005731) Human Tagged ORF Clone

SKU
RC200319
ARPC2 (Myc-DDK-tagged)-Human actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ARPC2
Synonyms ARC34; p34-Arc; PNAS-139; PRO2446
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200319 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCTGCTGGAGGTGAACAACCGCATCATCGAGGAGACGCTCGCGCTCAAGTTCGAGAACGCGGCCG
CCGGAAACAAACCGGAAGCAGTAGAAGTAACATTTGCAGATTTCGATGGGGTCCTCTATCATATTTCAAA
TCCTAATGGAGACAAAACAAAAGTGATGGTCAGTATTTCTTTGAAATTCTACAAGGAACTTCAGGCACAT
GGTGCTGATGAGTTATTAAAGAGGGTGTACGGGAGTTTCTTGGTAAATCCAGAATCAGGATACAATGTCT
CTTTGCTATATGACCTTGAAAATCTTCCGGCATCCAAGGATTCCATTGTGCATCAAGCTGGCATGTTGAA
GCGAAATTGTTTTGCCTCTGTCTTTGAAAAATACTTCCAATTCCAAGAAGAGGGCAAGGAAGGAGAGAAC
AGGGCAGTTATCCATTATAGGGATGATGAGACCATGTATGTTGAGTCTAAAAAGGACAGAGTCACAGTAG
TCTTCAGCACAGTGTTTAAGGATGACGACGATGTGGTCATTGGAAAGGTGTTCATGCAGGAGTTCAAAGA
AGGACGCAGAGCCAGCCACACAGCCCCACAGGTCCTCTTTAGCCACAGGGAACCTCCTCTGGAGCTGAAA
GACACAGACGCCGCTGTGGGTGACAACATTGGCTACATTACCTTTGTGCTGTTCCCTCGTCACACCAATG
CCAGTGCTCGAGACAACACCATCAACCTGATCCACACGTTCCGGGACTACCTGCACTACCACATCAAGTG
CTCTAAGGCCTATATTCACACACGTATGCGGGCGAAAACGTCTGACTTCCTCAAGGTGCTGAACCGCGCA
CGCCCAGATGCCGAGAAAAAAGAAATGAAAACAATCACGGGGAAGACGTTTTCATCCCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200319 protein sequence
Red=Cloning site Green=Tags(s)

MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAH
GADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGEN
RAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELK
DTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRA
RPDAEKKEMKTITGKTFSSR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005731
ORF Size 900 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005731.3
RefSeq Size 1419 bp
RefSeq ORF 903 bp
Locus ID 10109
UniProt ID O15144
Cytogenetics 2q35
Domains p34-Arc
Protein Pathways Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton
MW 34.3 kDa
Summary This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ARPC2 (NM_005731) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200319L3 Lenti ORF clone of Human actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200319L4 Lenti ORF clone of Human actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 2, mGFP tagged 10 ug
$600.00
RG200319 ARPC2 (tGFP-tagged) - Human actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC112686 ARPC2 (untagged)-Human actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.