MDH1 (NM_005917) Human Tagged ORF Clone

SKU
RC200298
MDH1 (Myc-DDK-tagged)-Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MDH1
Synonyms DEE88; EIEE88; HEL-S-32; KAR; MDH-s; MDHA; MGC:1375; MOR2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200298 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGAACCAATCAGAGTCCTTGTGACTGGAGCAGCTGGTCAAATTGCATATTCACTGCTGTACAGTA
TTGGAAATGGATCTGTCTTTGGTAAAGATCAGCCTATAATTCTTGTGCTGTTGGATATCACCCCCATGAT
GGGTGTCCTGGACGGTGTCCTAATGGAACTGCAAGACTGTGCCCTTCCCCTCCTGAAAGATGTCATCGCA
ACAGATAAAGAAGACGTTGCCTTCAAAGACCTGGATGTGGCCATTCTTGTGGGCTCCATGCCAAGAAGGG
AAGGCATGGAGAGAAAAGATTTACTGAAAGCAAATGTGAAAATCTTCAAATCCCAGGGTGCAGCCTTAGA
TAAATACGCCAAGAAGTCAGTTAAGGTTATTGTTGTGGGTAATCCAGCCAATACCAACTGCCTGACTGCT
TCCAAGTCAGCTCCATCCATCCCCAAGGAGAACTTCAGTTGCTTGACTCGTTTGGATCACAACCGAGCTA
AAGCTCAAATTGCTCTTAAACTTGGTGTGACTGCTAATGATGTAAAGAATGTCATTATCTGGGGAAACCA
TTCCTCGACTCAGTATCCAGATGTCAACCATGCCAAGGTGAAATTGCAAGGAAAGGAAGTTGGTGTTTAT
GAAGCTCTGAAAGATGACAGCTGGCTCAAGGGAGAATTTGTCACGACTGTGCAGCAGCGTGGCGCTGCTG
TCATCAAGGCTCGAAAACTATCCAGTGCCATGTCTGCTGCAAAAGCCATCTGTGACCACGTCAGGGACAT
CTGGTTTGGAACCCCAGAGGGAGAGTTTGTGTCCATGGGTGTTATCTCTGATGGCAACTCCTATGGTGTT
CCTGATGATCTGCTCTACTCATTCCCTGTTGTAATCAAGAATAAGACCTGGAAGTTTGTTGAAGGTCTCC
CTATTAATGATTTCTCACGTGAGAAGATGGATCTTACTGCAAAGGAACTGACAGAAGAAAAAGAAAGTGC
TTTTGAATTTCTTTCCTCTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200298 protein sequence
Red=Cloning site Green=Tags(s)

MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIA
TDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTA
SKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVY
EALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGV
PDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005917
ORF Size 1002 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005917.4
RefSeq Size 1665 bp
RefSeq ORF 1005 bp
Locus ID 4190
UniProt ID P40925
Cytogenetics 2p15
Domains ldh
Protein Families Druggable Genome
Protein Pathways Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Pyruvate metabolism
MW 36.4 kDa
Summary This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. Alternatively spliced transcript variants have been found for this gene. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Pseudogenes have been identified on chromosomes X and 6. [provided by RefSeq, Feb 2016]
Write Your Own Review
You're reviewing:MDH1 (NM_005917) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200298L1 Lenti ORF clone of Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC200298L2 Lenti ORF clone of Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2, mGFP tagged 10 ug
$757.00
RC200298L3 Lenti ORF clone of Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC200298L4 Lenti ORF clone of Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2, mGFP tagged 10 ug
$757.00
RG200298 MDH1 (tGFP-tagged) - Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC116447 MDH1 (untagged)-Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2 10 ug
$457.00
SC320854 MDH1 (untagged)-Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.