TMED1 (NM_006858) Human Tagged ORF Clone

SKU
RC200255
TMED1 (Myc-DDK-tagged)-Human transmembrane emp24 protein transport domain containing 1 (TMED1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TMED1
Synonyms Il1rl1l; IL1RL1LG; p24g1; Tp24
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200255 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGCGGCCGGCGCGGCCCTAGCCCTGGCCTTGTGGCTACTAATGCCACCAGTGGAGGTGGGAGGGG
CGGGGCCCCCGCCAATCCAGGACGGTGAGTTCACGTTCCTGTTGCCGGCGGGGAGGAAGCAGTGTTTCTA
CCAGTCCGCGCCGGCCAACGCAAGCCTCGAGACCGAATACCAGGTGATCGGAGGTGCTGGACTGGACGTG
GACTTCACGCTGGAGAGCCCTCAGGGCGTGCTGTTGGTCAGCGAGTCCCGCAAGGCTGATGGGGTACACA
CGGTGGAGCCAACGGAGGCCGGGGACTACAAGCTGTGCTTTGACAACTCCTTCAGCACCATCTCCGAGAA
GCTGGTGTTCTTTGAACTGATCTTTGACAGCCTCCAGGATGACGAGGAGGTCGAAGGATGGGCAGAGGCT
GTGGAGCCCGAGGAGATGCTGGATGTTAAAATGGAGGACATCAAGGAGTCCATTGAGACCATGCGGACCC
GGCTGGAGCGCAGCATCCAGATGCTCACGCTACTGCGGGCCTTCGAGGCACGTGACCGCAACCTGCAAGA
GGGCAACTTGGAGCGGGTCAACTTCTGGTCAGCTGTCAACGTGGCGGTGCTGCTGCTGGTGGCTGTGCTG
CAGGTCTGCACGCTCAAGCGCTTCTTCCAGGACAAGCGCCCGGTGCCCACG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200255 protein sequence
Red=Cloning site Green=Tags(s)

MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDV
DFTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEA
VEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVL
QVCTLKRFFQDKRPVPT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006858
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006858.4
RefSeq Size 1739 bp
RefSeq ORF 684 bp
Locus ID 11018
UniProt ID Q13445
Cytogenetics 19p13.2
Protein Families Druggable Genome, Transmembrane
MW 25.2 kDa
Summary This gene belongs to the TMED (transmembrane emp24 domain-containing) protein family, which is involved in the vesicular trafficking of proteins. The protein encoded by this gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1) and may play a role in innate immunity. This protein lacks any similarity to other interleukin 1 ligands. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:TMED1 (NM_006858) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200255L1 Lenti ORF clone of Human transmembrane emp24 protein transport domain containing 1 (TMED1), Myc-DDK-tagged 10 ug
$600.00
RC200255L2 Lenti ORF clone of Human transmembrane emp24 protein transport domain containing 1 (TMED1), mGFP tagged 10 ug
$600.00
RC200255L3 Lenti ORF clone of Human transmembrane emp24 protein transport domain containing 1 (TMED1), Myc-DDK-tagged 10 ug
$600.00
RC200255L4 Lenti ORF clone of Human transmembrane emp24 protein transport domain containing 1 (TMED1), mGFP tagged 10 ug
$600.00
RG200255 TMED1 (tGFP-tagged) - Human transmembrane emp24 protein transport domain containing 1 (TMED1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC303832 TMED1 (untagged)-Human transmembrane emp24 protein transport domain containing 1 (TMED1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.