HRASLS3 (PLA2G16) (NM_007069) Human Tagged ORF Clone

SKU
RC200242
PLA2G16 (Myc-DDK-tagged)-Human phospholipase A2, group XVI (PLA2G16), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HRASLS3
Synonyms AdPLA; H-REV107; H-REV107-1; HRASLS3; HREV107; HREV107-1; HREV107-3; HRSL3; PLA2G16; PLAAT-3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200242 representing NM_007069
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGTGCGCCCATTCCAGAGCCTAAGCCTGGAGACCTGATTGAGATTTTTCGCCCTTTCTACAGACACT
GGGCCATCTATGTTGGCGATGGATATGTGGTTCATCTGGCCCCTCCAAGTGAGGTCGCAGGAGCTGGTGC
AGCCAGTGTCATGTCCGCCCTGACTGACAAGGCCATCGTGAAGAAGGAATTGCTGTATGATGTGGCCGGG
AGTGACAAGTACCAGGTCAACAACAAACATGATGACAAGTACTCGCCGCTGCCCTGCAGCAAAATCATCC
AGCGGGCGGAGGAGCTGGTGGGGCAGGAGGTGCTCTACAAGCTGACCAGTGAGAACTGCGAGCACTTTGT
GAATGAGCTGCGCTATGGAGTCGCCCGCAGTGACCAGGTCAGAGATGTCATCATCGCTGCAAGCGTTGCA
GGAATGGGCTTGGCAGCCATGAGCCTTATTGGAGTCATGTTCTCAAGAAACAAGCGACAAAAGCAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200242 representing NM_007069
Red=Cloning site Green=Tags(s)

MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG
SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA
GMGLAAMSLIGVMFSRNKRQKQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007069
ORF Size 486 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007069.3
RefSeq Size 1070 bp
RefSeq ORF 489 bp
Locus ID 11145
UniProt ID P53816
Cytogenetics 11q12.3-q13.1
Domains NC
Protein Families Druggable Genome, Transmembrane
MW 17.9 kDa
Summary Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381, PubMed:26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381, PubMed:22923616). For most substrates, PLA1 activity is much higher than PLA2 activity (PubMed:19615464). Shows O-acyltransferase activity,catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid (PubMed:19615464). Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs) (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381). Exhibits high N-acyltransferase activity and low phospholipase A1/2 activity (PubMed:22825852).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:HRASLS3 (PLA2G16) (NM_007069) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200242L1 Lenti ORF clone of Human phospholipase A2, group XVI (PLA2G16), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC200242L2 Lenti ORF clone of Human phospholipase A2, group XVI (PLA2G16), transcript variant 1, mGFP tagged 10 ug
$450.00
RC200242L3 Lenti ORF clone of Human phospholipase A2, group XVI (PLA2G16), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC200242L4 Lenti ORF clone of Human phospholipase A2, group XVI (PLA2G16), transcript variant 1, mGFP tagged 10 ug
$450.00
RG200242 PLA2G16 (tGFP-tagged) - Human phospholipase A2, group XVI (PLA2G16), transcript variant 1 10 ug
$489.00
SC126921 PLA2G16 (untagged)-Human phospholipase A2, group XVI (PLA2G16), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.