SLC25A20 (NM_000387) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC200234
SLC25A20 (Myc-DDK-tagged)-Human solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 (SLC25A20), nuclear gene encoding mitochondrial protein
$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SLC25A20
Synonyms CAC; CACT
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200234 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGACCAGCCAAAACCCATCAGCCCGCTCAAGAACCTGCTGGCCGGCGGCTTTGGCGGCGTGTGCC
TGGTGTTCGTCGGTCACCCTCTGGACACGGTCAAGGTCCGACTGCAGACACAGCCACCGAGTTTGCCTGG
ACAACCTCCCATGTACTCTGGGACCTTTGACTGTTTCCGGAAGACTCTTTTTAGAGAGGGCATCACGGGG
CTATATCGGGGAATGGCTGCCCCTATCATCGGGGTCACTCCCATGTTTGCCGTGTGCTTCTTTGGGTTTG
GTTTGGGGAAGAAACTACAACAGAAACACCCAGAAGATGTGCTCAGCTATCCCCAGCTTTTTGCAGCTGG
GATGTTATCTGGCGTATTCACCACAGGAATCATGACTCCTGGAGAACGGATCAAGTGCTTATTACAGATT
CAGGCTTCTTCAGGAGAAAGCAAGTACACTGGTACCTTGGACTGTGCAAAGAAGCTGTACCAGGAGTTTG
GGATCCGAGGCATCTACAAAGGGACTGTGCTTACCCTTATGCGAGATGTCCCAGCTAGTGGAATGTATTT
CATGACATATGAATGGCTGAAAAATATCTTCACTCCGGAGGGAAAGAGGGTCAGTGAGCTCAGTGCCCCT
CGGATCTTGGTGGCTGGGGGCATTGCAGGGATCTTCAACTGGGCTGTGGCAATCCCCCCAGATGTGCTCA
AGTCTCGATTCCAGACTGCACCTCCTGGGAAATATCCTAATGGTTTCAGAGATGTGCTGAGGGAGCTGAT
CCGGGATGAAGGAGTCACATCCTTGTACAAAGGGTTCAATGCAGTGATGATCCGAGCCTTCCCAGCCAAT
GCGGCCTGTTTCCTTGGCTTTGAAGTTGCCATGAAGTTCCTTAATTGGGCCACCCCCAACTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200234 protein sequence
Red=Cloning site Green=Tags(s)

MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITG
LYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQI
QASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAP
RILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPAN
AACFLGFEVAMKFLNWATPNL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000387
ORF Size 903 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000387.6
RefSeq Size 1909 bp
RefSeq ORF 906 bp
Locus ID 788
UniProt ID O43772
Cytogenetics 3p21.31
Domains mito_carr
Protein Families Druggable Genome, Transmembrane
MW 32.9 kDa
Summary This gene product is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. This protein mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants. [provided by RefSeq, Jul 2008]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
RC200234L1 Lenti ORF clone of Human solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 (SLC25A20), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC200234L2 Lenti ORF clone of Human solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 (SLC25A20), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RC200234L3 Lenti ORF clone of Human solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 (SLC25A20), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC200234L4 Lenti ORF clone of Human solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 (SLC25A20), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RG200234 SLC25A20 (tGFP-tagged) - Human solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 (SLC25A20), nuclear gene encoding mitochondrial protein 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC320229 SLC25A20 (untagged)-Human solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 (SLC25A20), nuclear gene encoding mitochondrial protein 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.