NUDT5 (NM_014142) Human Tagged ORF Clone

SKU
RC200204
NUDT5 (Myc-DDK-tagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NUDT5
Synonyms hNUDT5; YSA1; YSA1H; YSAH1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200204 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGCCAAGAACCAACGGAATCTTCTCAGAATGGCAAACAGTATATCATTTCAGAGGAGTTAATTT
CAGAAGGAAAATGGGTCAAGCTTGAAAAAACAACGTACATGGATCCTACTGGTAAAACTAGAACTTGGGA
ATCAGTGAAACGTACAACCAGGAAAGAGCAGACTGCGGATGGTGTCGCGGTCATCCCCGTGCTGCAGAGA
ACACTTCACTATGAGTGTATCGTTCTGGTGAAACAGTTCCGACCACCAATGGGGGGCTACTGCATAGAGT
TCCCTGCAGGTCTCATAGATGATGGTGAAACCCCAGAAGCAGCTGCTCTCCGGGAGCTTGAAGAAGAAAC
TGGCTACAAAGGGGACATTGCCGAATGTTCTCCAGCGGTCTGTATGGACCCAGGCTTGTCAAACTGTACT
ATACACATCGTGACAGTCACCATTAACGGAGATGATGCCGAAAACGCAAGGCCGAAGCCAAAGCCAGGGG
ATGGAGAGTTTGTGGAAGTCATTTCTTTACCCAAGAATGACCTGCTGCAGAGACTTGATGCTCTGGTAGC
TGAAGAACATCTCACAGTGGACGCCAGGGTCTATTCCTACGCTCTAGCACTGAAACATGCAAATGCAAAG
CCATTTGAAGTGCCCTTCTTGAAATTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200204 protein sequence
Red=Cloning site Green=Tags(s)

MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQR
TLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCT
IHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAK
PFEVPFLKF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014142
ORF Size 657 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014142.4
RefSeq Size 1224 bp
RefSeq ORF 660 bp
Locus ID 11164
UniProt ID Q9UKK9
Cytogenetics 10p14
Domains NUDIX
Protein Pathways Purine metabolism
MW 24.3 kDa
Summary This gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors. [provided by RefSeq, Aug 2013]
Write Your Own Review
You're reviewing:NUDT5 (NM_014142) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200204L1 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5), Myc-DDK-tagged 10 ug
$600.00
RC200204L2 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5), mGFP tagged 10 ug
$600.00
RC200204L3 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5), Myc-DDK-tagged 10 ug
$600.00
RC200204L4 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5), mGFP tagged 10 ug
$600.00
RG200204 NUDT5 (tGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319410 NUDT5 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.