C9orf95 (NMRK1) (NM_017881) Human Tagged ORF Clone

SKU
RC200160
NMRK1 (Myc-DDK-tagged)-Human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C9orf95
Synonyms bA235O14.2; C9orf95; NRK1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200160 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAACATTTATCATTGGAATCAGTGGTGTGACAAACAGTGGCAAAACAACACTGGCTAAGAATTTGC
AGAAACACCTCCCAAATTGCAGTGTCATATCTCAGGATGATTTCTTCAAGCCAGAGTCTGAGATAGAGAC
AGATAAAAATGGATTTTTGCAGTACGATGTGCTTGAAGCACTTAACATGGAAAAAATGATGTCAGCCATT
TCCTGCTGGATGGAAAGCGCAAGACACTCTGTGGTATCAACAGACCAGGAAAGTGCTGAGGAAATTCCCA
TTTTAATCATCGAAGGTTTTCTTCTTTTTAATTATAAGCCCCTTGACACTATATGGAATAGAAGCTATTT
CCTGACGATTCCATATGAAGAATGTAAAAGGAGGAGGAGTACAAGGGTCTATCAGCCTCCAGACTCTCCG
GGATACTTTGATGGCCATGTGTGGCCCATGTATCTAAAGTACAGACAAGAAATGCAGGACATCACATGGG
AAGTTGTGTACCTGGATGGAACAAAATCTGAAGAGGACCTCTTTTTGCAAGTATATGAAGATCTAATACA
AGAACTAGCAAAGCAAAAGTGTTTGCAAGTGACAGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200160 protein sequence
Red=Cloning site Green=Tags(s)

MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAI
SCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSP
GYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_017881
ORF Size 597 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_017881.3
RefSeq Size 1207 bp
RefSeq ORF 600 bp
Locus ID 54981
UniProt ID Q9NWW6
Cytogenetics 9q21.13
Protein Pathways Nicotinate and nicotinamide metabolism
MW 23.2 kDa
Summary Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:C9orf95 (NMRK1) (NM_017881) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200160L3 Lenti ORF clone of Human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200160L4 Lenti ORF clone of Human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1, mGFP tagged 10 ug
$600.00
RG200160 NMRK1 (tGFP-tagged) - Human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC113922 NMRK1 (untagged)-Human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1 10 ug
$300.00
SC320608 NMRK1 (untagged)-Human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.