Apc11 (ANAPC11) (NM_001002244) Human Tagged ORF Clone

SKU
RC200097
ANAPC11 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Apc11
Synonyms APC11; Apc11p; HSPC214
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200097 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGTGAAGATTAAGTGCTGGAACGGCGTGGCCACTTGGCTCTGGGTGGCCAACGATGAGAACTGTG
GCATCTGCAGGATGGCATTTAACGGATGCTGCCCTGACTGTCCTCTCCATGGAGAAAGCATTTCTAGGTG
TTTGGGCTGGTGCCCGCAGCCTGTGCCTGTCCTGGGAGGCAGGGCCCATCCACAGGTGCCCATCAACACA
GCTTCCCCAACGCCTGGGCAGCACACCGGATCCCTGATGTCTAGGGAAGAGTCTTCTAGGTCCCCAGACC
CCACCCCTCCTGCCCTTGATCAAGAGACCAGTTCACTACTCAGATGCACGTCTCCTTGGTGCCTTGACCA
TTCATGTGACCTTTTTGGCATCACAGATCAAGTGTCTGCAGATGGGCCCAGGGCCTGTAGGCAAGGTGCC
CGGCGACGACTGCCCGCTGGTGTGGGGCCAGTGCTCCCACTGCTTCCACATGCATTGCATCCTCAAGTGG
CTGCACGCACAGCAGGTGCAGCAGCACTGCCCCATGTGCCGCCAGGAATGGAAGTTCAAGGAGTGAGGCC
CGACCTGGCTCTCGCTGGAGGGGCATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200097 protein sequence
Red=Cloning site Green=Tags(s)

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCPLHGESISRCLGWCPQPVPVLGGRAHPQVPINT
ASPTPGQHTGSLMSREESSRSPDPTPPALDQETSSLLRCTSPWCLDHSCDLFGITDQVSADGPRACRQGA
RRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGMEVQGVRPDLALAGGAS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001002244
ORF Size 588 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001002244.2, NP_001002244.1
RefSeq Size 1186 bp
RefSeq ORF 591 bp
Locus ID 51529
UniProt ID Q9NYG5
Cytogenetics 17q25.3
Protein Families Druggable Genome
Protein Pathways Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis
MW 20.6 kDa
Summary Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Apc11 (ANAPC11) (NM_001002244) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200097L3 Lenti ORF clone of Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200097L4 Lenti ORF clone of Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1, mGFP tagged 10 ug
$600.00
RG200097 ANAPC11 (tGFP-tagged) - Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC300411 ANAPC11 (untagged)-Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1 10 ug
$330.00
SC320636 ANAPC11 (untagged)-Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.