CINP (NM_032630) Human Tagged ORF Clone

SKU
RC200085
CINP (Myc-DDK-tagged)-Human cyclin-dependent kinase 2 interacting protein (CINP), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CINP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200085 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGCAAAGACTCTTGGAACTGTAACGCCCAGAAAACCTGTCTTATCTGTCAGTGCAAGAAAAATTA
AGGACAATGCGGCTGATTGGCACAATTTAATCCTGAAGTGGGAAACCCTCAATGATGCAGGTTTTACCAC
TGCAAATAATATTGCCAACTTGAAAATCAGTTTATTGAATAAAGACAAGATAGAACTAGACAGCAGCAGC
CCAGCCTCGAAGGAAAATGAAGAAAAGGTGTGTCTGGAATATAACGAGGAACTGGAGAAGCTGTGTGAGG
AACTGCAGGCCACCTTGGATGGGTTGACCAAAATACAGGTGAAAATGGAAAAGCTGTCTTCAACTACCAA
GGGAATTTGTGAACTAGAAAACTACCATTATGGGGAGGAGAGTAAACGACCCCCTCTGTTCCACACGTGG
CCTACAACCCATTTCTATGAGGTTTCGCATAAGCTCTTGGAGATGTACAGGAAGGAGCTGCTCCTGAAGC
GCACGGTGGCCAAGGAGCTTGCCCACACCGGGGATCCCGACCTCACCCTGAGCTACCTGTCCATGTGGCT
GCACCAGCCCTATGTGGAGAGCGACAGTAGGCTGCATCTGGAGAGCATGCTGCTGGAGACAGGCCACCGA
GCTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200085 protein sequence
Red=Cloning site Green=Tags(s)

MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSS
PASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTW
PTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHR
AL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032630
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032630.1
RefSeq Size 996 bp
RefSeq ORF 639 bp
Locus ID 51550
UniProt ID Q9BW66
Cytogenetics 14q32.31
Protein Families Druggable Genome
MW 24.3 kDa
Summary The protein encoded by this gene is reported to be a component of the DNA replication complex as well as a genome-maintenance protein. It may interact with proteins important for replication initiation and has been shown to bind chromatin at the G1 phase of the cell cycle and dissociate from chromatin with replication initiation. It may also serve to regulate checkpoint signaling as part of the DNA damage response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Write Your Own Review
You're reviewing:CINP (NM_032630) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200085L1 Lenti ORF clone of Human cyclin-dependent kinase 2 interacting protein (CINP), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200085L2 Lenti ORF clone of Human cyclin-dependent kinase 2 interacting protein (CINP), transcript variant 2, mGFP tagged 10 ug
$600.00
RC200085L3 Lenti ORF clone of Human cyclin-dependent kinase 2 interacting protein (CINP), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200085L4 Lenti ORF clone of Human cyclin-dependent kinase 2 interacting protein (CINP), transcript variant 2, mGFP tagged 10 ug
$600.00
RG200085 CINP (tGFP-tagged) - Human cyclin-dependent kinase 2 interacting protein (CINP), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC104191 CINP (untagged)-Human cyclin-dependent kinase 2 interacting protein (CINP), transcript variant 2 10 ug
$300.00
SC324371 CINP (untagged)-Human cyclin-dependent kinase 2 interacting protein (CINP), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.