Rnpc3 (NM_001038696) Mouse Tagged ORF Clone

CAT#: MR230331

Reviews ()
Write a review
  • TrueORF®

Rnpc3 (myc-DDK-tagged) - Mouse RNA-binding region (RNP1, RRM) containing 3 (Rnpc3), transcript variant 1

  View "NM_001038696" in other vectors (1)

Interest in protein/lysate? Sumbit request here!

USD 540.00


Availability*
4 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Rnpc3 (NM_001038696) Mouse Tagged ORF Clone
Symbol Rnpc3
Synonyms 2810441O16Rik; AI447568; C030014B17Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR230331 representing NM_001038696
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGGCCTGAGCCGCCGATGCCGCTGTCCCGAGGCGGCCCAGGCTCCGCTTCGCTTTCTCCGCCCC
GGGGAGACCGCACCCTCCTCGTCAGGCACCTGCCGGCCGAGCTGACGGCTGAGGAGAAGGAGGACTTACT
GAAGTACTTCGGGGCGCAGTCGGTGCGCGTCCTGTCAGATAAGGGGCGCCTGAAACACACAGCATTTGCT
ACTTTCCCTAATGAAAAAGCAGCAATAAAGGCACTGACGAGACTCCATCAGCTGAAACTTCTAGGTCATA
CTTTAGTTGTTGAATTTGCAAAAGAGCAAGATCGAGTTCACTCCCCATGTTCCACCTCAAATACAGAGAA
AAAGAAAAGGTTGGATGACACTGTGGAAAATGATAAAGAGAAGAAAGAACCTGACATTTTAACAGTAGAA
AATGGAATTGCACCAAATCATGGGCTGACTTTTCCTCTGAATTCATGCCTTAAATATATGTATCCTCCAC
CATCAAGCACAATCCTCGCAAATATAGTAAATGCTCTGGCAAGTGTCCCAAAATTCTATGTACAGGTGCT
TCATCTTATGAATAAAATGAATTTGCCCACACCATTTGGACCGATTACTGCACGACCTCCTATGTATGAG
GACTATATGCCATTGCATGCACCCCTTCCACCTACATCCCCTCAACCGCCTGAGGAGCCTCCCTTACCAG
ATGAGGATGAGGATTTATCTAGCAAAGAATCAGAATATGAAAGCAGTGATGAGGAGGACCGACAGAGAAT
GAACAGATTAATGGAACTAGCAAATCTTCAGCCCAAAAGACCCAAAACAGAAAAGCCACGCCACGTGAGA
AAAAAGCGAAAAATAAAGGATATGTTGAATATACCTTCATCAGCTTCACATAGTTTGCATCCTGTGCTGT
TACCTTCGGATGTATTTGACCAGCCACAATCTGTAGGTAATAAAAAAATTGAGTTCAATATATCAACCAA
CATGCCTGCAGCATTTAACAAAGATTTGGAGACACAACCAAATAATGAAGAAGAAAATTCTGATTCACCA
GACACTGGACTTGATTCAAATACAGGATTTGGCAAAATCTTCCCTAAACCTAATTTGAACATCACAGAAG
AGATTACAGAAGACTCTGATGAAATACCTTCACAATTTATTTCTAGAAAAGAGTTGGAAAAGGGTCGTAT
TTCTAGAGAAGAAATGGAAACACTTTCAGTTTTTAGAAGTTATGAACCTGGTGAACCAAACTGCAGAATT
TATGTAAAGAATTTAGCTAGACATGTTCAGGAAAAGGACCTTAAATTTATATTTGGAAGATACGTTGACT
TTTCTTCAGAAACACAGCGGATCATGTTTGATATTCGCTTAATGAAAGAAGGACGCATGAAAGGACAAGC
TTTTGTTGGACTTCCAAATGAAAAAGCAGCCGCTAAAGCGTTGAAAGAAGCTAATGGCTATGTTCTTTTT
GGAAAACCCATGGTGGTTCAGTTTGCTCGATCTGCTAGACCAAAACAGGATTCTAAAGAAGGAAAACGGA
AG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR230331 representing NM_001038696
Red=Cloning site Green=Tags(s)

MAGPEPPMPLSRGGPGSASLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTAFA
TFPNEKAAIKALTRLHQLKLLGHTLVVEFAKEQDRVHSPCSTSNTEKKKRLDDTVENDKEKKEPDILTVE
NGIAPNHGLTFPLNSCLKYMYPPPSSTILANIVNALASVPKFYVQVLHLMNKMNLPTPFGPITARPPMYE
DYMPLHAPLPPTSPQPPEEPPLPDEDEDLSSKESEYESSDEEDRQRMNRLMELANLQPKRPKTEKPRHVR
KKRKIKDMLNIPSSASHSLHPVLLPSDVFDQPQSVGNKKIEFNISTNMPAAFNKDLETQPNNEEENSDSP
DTGLDSNTGFGKIFPKPNLNITEEITEDSDEIPSQFISRKELEKGRISREEMETLSVFRSYEPGEPNCRI
YVKNLARHVQEKDLKFIFGRYVDFSSETQRIMFDIRLMKEGRMKGQAFVGLPNEKAAAKALKEANGYVLF
GKPMVVQFARSARPKQDSKEGKRK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001038696
ORF Size 1542 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001038696.1, NP_001033785
RefSeq Size 3888
RefSeq ORF 1545
Locus ID 67225
Cytogenetics 3 F3
MW 58.4 kDa

Other Versions

Other products for "Rnpc3"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones