Cib1 (NM_001291275) Mouse Tagged ORF Clone

SKU
MR228359
Cib1 (myc-DDK-tagged) - Mouse calcium and integrin binding 1 (calmyrin) (Cib1), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
2 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cib1
Synonyms Cibkip; Kip; Prkdcip
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR228359 representing NM_001291275
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGGTTCGGGCAGTCGCCTGTCTAAGGAGCTGCTGGCCGAGTACCAGGACCTGACGTTCCTGACCA
AGCAGGAGATCCTCCTAGCCCACAGACGCTTTTGTGAGCTGCTTCCCCCAGAGCAGCGGACCGTGGAGGA
GTCACTGCACACCCGAGTATCGTTTGAGCAGATCCTCAGCCTCCCAGAGCTCAAGGAGCGAATCTGCATG
GTCTTCTCCACATCACCTACCAGAGACAGCCTGAGCTTTGAGGACTTCCTGGACCTCCTGAGTGTCTTCA
GTGACACAGCAACCCCAGACATCAAGTCACACTATGCCTTCCGCATCTTTGACTTTGATGACGATGGAAC
CCTGGACAGAGAAGACCTGAGCCAGCTTGTGAATTGCCTCACGGGAGAGGGCGAGGACACTCGGCTCAGT
GCTTCTGAGATGAAGCAGCTGATTGACAATATCCTGGAAGAGTCAGACATTGACAGGGATGGGACCATCA
ATCTTTCCGAGTTCCAGCATGTCATCTCGCGCTCACCAGACTTTGCCAGCTCCTTTAAGATTGTCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR228359 representing NM_001291275
Red=Cloning site Green=Tags(s)

MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEQRTVEESLHTRVSFEQILSLPELKERICM
VFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLDREDLSQLVNCLTGEGEDTRLS
ASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001291275
ORF Size 558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001291275.1, NP_001278204.1
RefSeq Size 1040 bp
RefSeq ORF 561 bp
Locus ID 23991
UniProt ID Q9Z0F4
Cytogenetics 7 D2
MW 21.7 kDa
Summary Calcium-binding protein that plays a role in the regulation of numerous cellular processes, such as cell differentiation, cell division, cell proliferation, cell migration, thrombosis, angiogenesis, cardiac hypertrophy and apoptosis. Involved in bone marrow megakaryocyte differentiation by negatively regulating thrombopoietin-mediated signaling pathway. Participates in the endomitotic cell cycle of megakaryocyte, a form of mitosis in which both karyokinesis and cytokinesis are interrupted. Plays a role in integrin signaling by negatively regulating alpha-IIb/beta3 activation in thrombin-stimulated megakaryocytes preventing platelet aggregation. Up-regulates PTK2/FAK1 activity, and is also needed for the recruitment of PTK2/FAK1 to focal adhesions; it thus appears to play an important role in focal adhesion formation. Positively regulates cell migration on fibronectin in a CDC42-dependent manner, the effect being negatively regulated by PAK1. Functions as a negative regulator of stress activated MAP kinase (MAPK) signaling pathways. Down-regulates inositol 1,4,5-trisphosphate receptor-dependent calcium signaling. Involved in sphingosine kinase SPHK1 translocation to the plasma membrane in a N-myristoylation-dependent manner preventing TNF-alpha-induced apoptosis. Regulates serine/threonine-protein kinase PLK3 activity for proper completion of cell division progression. Plays a role in microtubule (MT) dynamics during neuronal development; disrupts the MT depolymerization activity of STMN2 attenuating NGF-induced neurite outgrowth and the MT reorganization at the edge of lamellipodia. Promotes cardiomyocyte hypertrophy via activation of the calcineurin/NFAT signaling pathway. Stimulates calcineurin PPP3R1 activity by mediating its anchoring to the sarcolemma. In ischemia-induced (pathological or adaptive) angiogenesis, stimulates endothelial cell proliferation, migration and microvessel formation by activating the PAK1 and ERK1/ERK2 signaling pathway. Promotes also cancer cell survival and proliferation. May regulate cell cycle and differentiation of spermatogenic germ cells, and/or differentiation of supporting Sertoli cells.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cib1 (NM_001291275) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC226148 Cib1 (untagged) - Mouse calcium and integrin binding 1 (calmyrin) (Cib1), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.