Cd8a (NM_001081110) Mouse Tagged ORF Clone

SKU
MR227539
Cd8a (Myc-DDK-tagged) - Mouse CD8 antigen, alpha chain (Cd8a), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cd8a
Synonyms BB154331; Ly-2; Ly-35; Ly-B; Lyt-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR227539 representing NM_001081110
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCACCGTTGACCCGCTTTCTGTCGCTGAACCTGCTGCTGCTGGGTGAGTCGATTATCCTGGGGA
GTGGAGAAGCTAAGCCACAGGCACCCGAACTCCGAATCTTTCCAAAGAAAATGGACGCCGAACTTGGTCA
GAAGGTGGACCTGGTATGTGAAGTGTTGGGGTCCGTTTCGCAAGGATGCTCTTGGCTCTTCCAGAACTCC
AGCTCCAAACTCCCCCAGCCCACCTTCGTTGTCTATATGGCTTCATCCCACAACAAGATAACGTGGGACG
AGAAGCTGAATTCGTCGAAACTGTTTTCTGCCATGAGGGACACGAATAATAAGTACGTTCTCACCCTGAA
CAAGTTCAGCAAGGAAAACGAAGGCTACTATTTCTGCTCAGTCATCAGCAACTCGGTGATGTACTTCAGT
TCTGTCGTGCCAGTCCTTCAGAAAGTGAACTCTACTACTACCAAGCCAGTGCTGCGAACTCCCTCACCTG
TGCACCCTACCGGGACATCTCAGCCCCAGAGACCAGAAGATTGTCGGCCCCGTGGCTCAGTGAAGGGGAC
CGGATTGGACTTCGCCTGTGATATTTACATCTGGGCACCCTTGGCCGGAATCTGCGTGGCCCTTCTGCTG
TCCTTGATCATCACTCTCATCTGCTACCACAGGAGCCGAAAGCGTGTTTGCAAATGTCCCAGGCCGCTAG
TCAGACAGGAAGGCAAGCCCAGACCTTCAGAGAAAATTGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR227539 representing NM_001081110
Red=Cloning site Green=Tags(s)

MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNS
SSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFS
SVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLL
SLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001081110
ORF Size 741 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001081110.2, NP_001074579.1
RefSeq Size 3130 bp
RefSeq ORF 744 bp
Locus ID 12525
UniProt ID P01731
Cytogenetics 6 32.14 cM
MW 27.9 kDa
Summary Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cd8a (NM_001081110) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208266 Cd8a (untagged) - Mouse CD8 antigen, alpha chain (Cd8a), transcript variant 1, (10ug) 10 ug
$300.00
MG227539 Cd8a (tGFP-tagged) - Mouse CD8 antigen alpha chain (Cd8a) transcript variant 1, (10ug) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR227539L1 Lenti ORF clone of Cd8a (Myc-DDK-tagged) - Mouse CD8 antigen, alpha chain (Cd8a), transcript variant 1 10 ug
$600.00
MR227539L2 Lenti ORF clone of Cd8a (mGFP-tagged) - Mouse CD8 antigen, alpha chain (Cd8a), transcript variant 1 10 ug
$600.00
MR227539L3 Lenti ORF clone of Cd8a (Myc-DDK-tagged) - Mouse CD8 antigen, alpha chain (Cd8a), transcript variant 1 10 ug
$600.00
MR227539L4 Lenti ORF clone of Cd8a (mGFP-tagged) - Mouse CD8 antigen, alpha chain (Cd8a), transcript variant 1 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.