Myog (NM_031189) Mouse Tagged ORF Clone

SKU
MR227400
Myog (Myc-DDK-tagged) - Mouse myogenin (Myog)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Myog
Synonyms bHLHc3; MYF4; myo
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR227400 representing NM_031189
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGTATGAGACATCCCCCTATTTCTACCAGGAGCCCCACTTCTATGATGGGGAAAACTACCTTC
CTGTCCACCTTCAGGGCTTCGAGCCCCCGGGCTATGAGCGGACTGAGCTCAGCTTAAGCCCGGAAGCCCG
AGGGCCCCTGGAAGAAAAGGGACTGGGGACCCCTGAGCATTGTCCAGGCCAGTGCCTGCCGTGGGCATGT
AAGGTGTGTAAGAGGAAGTCTGTGTCGGTGGACCGGAGGAGGGCAGCCACACTGAGGGAGAAGCGCAGGC
TCAAGAAAGTGAATGAGGCCTTCGAGGCCCTGAAGAGGAGCACCCTGCTCAACCCCAACCAGCGGCTGCC
TAAAGTGGAGATCCTGCGCAGCGCCATCCAGTACATTGAGCGCCTACAGGCCTTGCTCAGCTCCCTCAAC
CAGGAGGAGCGCGATCTCCGCTACAGAGGCGGGGGCGGGCCCCAGCCCATGGTGCCCAGTGAATGCAACT
CCCACAGCGCCTCCTGCAGTCCGGAGTGGGGCAATGCACTGGAGTTCGGTCCCAACCCAGGAGATCATTT
GCTCGCGGCTGACCCTACAGACGCCCACAATCTGCACTCCCTTACGTCCATCGTGGACAGCATCACGGTG
GAGGATATGTCTGTTGCCTTCCCAGACGAAACCATGCCCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR227400 representing NM_031189
Red=Cloning site Green=Tags(s)

MELYETSPYFYQEPHFYDGENYLPVHLQGFEPPGYERTELSLSPEARGPLEEKGLGTPEHCPGQCLPWAC
KVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLN
QEERDLRYRGGGGPQPMVPSECNSHSASCSPEWGNALEFGPNPGDHLLAADPTDAHNLHSLTSIVDSITV
EDMSVAFPDETMPN

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_031189
ORF Size 672 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_031189.2, NP_112466.1
RefSeq Size 1518 bp
RefSeq ORF 675 bp
Locus ID 17928
UniProt ID P12979
Cytogenetics 1 58.18 cM
MW 25.7 kDa
Summary Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation, cell cycle exit and muscle atrophy. Essential for the development of functional embryonic skeletal fiber muscle differentiation. However is dispensable for postnatal skeletal muscle growth; phosphorylation by CAMK2G inhibits its transcriptional activity in respons to muscle activity. Required for the recruitment of the FACT complex to muscle-specific promoter regions, thus promoting gene expression initiation. During terminal myoblast differentiation, plays a role as a strong activator of transcription at loci with an open chromatin structure previously initiated by MYOD1. Together with MYF5 and MYOD1, co-occupies muscle-specific gene promoter core regions during myogenesis. Cooperates also with myocyte-specific enhancer factor MEF2D and BRG1-dependent recruitment of SWI/SNF chromatin-remodeling enzymes to alter chromatin structure at myogenic late gene promoters. Facilitates cell cycle exit during terminal muscle differentiation through the up-regulation of miR-20a expression, which in turn represses genes involved in cell cycle progression. Binds to the E-box containing (E1) promoter region of the miR-20a gene. Plays also a role in preventing reversal of muscle cell differentiation. Contributes to the atrophy-related gene expression in adult denervated muscles. Induces fibroblasts to differentiate into myoblasts.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Myog (NM_031189) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC209008 Myog (untagged) - Mouse myogenin (Myog), (10ug) 10 ug
$300.00
MG227400 Myog (tGFP-tagged) - Mouse myogenin (Myog), (10ug) 10 ug
$650.00
MR227400L3 Lenti ORF clone of Myog (Myc-DDK-tagged) - Mouse myogenin (Myog) 10 ug
$750.00
MR227400L4 Lenti ORF clone of Myog (mGFP-tagged) - Mouse myogenin (Myog) 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.