Prkaa1 (NM_001013367) Mouse Tagged ORF Clone

SKU
MR227383
Prkaa1 (Myc-DDK-tagged) - Mouse protein kinase, AMP-activated, alpha 1 catalytic subunit (Prkaa1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$780.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Prkaa1
Synonyms AI194361; AI450832; AL024255; AMPKalpha1; C130083N04Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR227383 representing NM_001013367
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGCAGACTCAGTTCCTGGAGAAAGATGGCGACGGCCGAGAAGCAGAAGCACGACGGGCGGGTGAAGA
TCGGCCACTACATCCTGGGGGACACGCTTGGTGTCGGCACCTTCGGGAAAGTGAAGGTGGGCAAGCACGA
GTTGACCGGACATAAAGTGGCTGTGAAGATACTCAACCGGCAGAAGATTCGGAGCCTTGACGTGGTGGGA
AAAATCCGCCGGGAGATTCAGAACCTGAAGCTGTTCAGGCACCCTCACATCATCAAACTGTACCAGGTCA
TCAGTACACCATCTGATATTTTCATGGTGATGGAATATGTCTCTGGAGGAGAGCTATTTGATTATATCTG
TAAAAATGGAAGGTTGGACGAAAAGGAAAGCCGCCGTCTGTTCCAGCAGATCCTTTCCGGTGTGGATTAT
TGTCACAGGCATATGGTGGTCCACAGAGATTTGAAACCTGAGAACGTCCTGCTTGATGCACACATGAATG
CAAAGATAGCCGACTTTGGTCTTTCAAACATGATGTCAGATGGTGAATTTTTAAGAACAAGCTGTGGCTC
ACCCAATTATGCCGCACCAGAAGTCATTTCAGGAAGATTGTACGCAGGCCCCGAGGTGGACATCTGGAGC
AGCGGGGTCATTCTCTATGCTTTGCTGTGTGGAACCCTCCCTTTTGATGATGACCATGTGCCAACTCTTT
TTAAGAAGATATGTGATGGGATCTTTTATACCCCTCAGTACTTAAACCCTTCAGTAATCAGCCTTTTGAA
ACATATGCTGCAGGTGGATCCCATGAAGAGGGCCGCAATAAAAGATATCAGGGAACACGAGTGGTTTAAA
CAGGACCTTCCGAAGTATCTCTTTCCTGAGGACCCATCTTATAGTTCAACCATGATCGATGACGAAGCCT
TGAAAGAAGTGTGTGAGAAGTTCGAGTGTTCGGAGGAGGAGGTCCTCAGCTGCCTGTACAACAGAAACCA
CCAGGACCCACTAGCCGTCGCCTACCACCTCATCATAGACAACAGGAGAATAATGAATGAAGCCAAAGAT
TTCTACCTAGCAACCAGCCCACCTGACTCTTTCCTGGACGACCACCATTTAACTCGGCCTCACCCTGAAA
GAGTACCGTTCTTGGTTGCCGAAACACCACGGGCCCGGCACACCCTGGATGAATTAAACCCACAGAAATC
CAAACACCAAGGTGTACGGAAGGCAAAATGGCATTTGGGAATTCGAAGTCAAAGCCGACCCAATGATATC
ATGGCAGAAGTTTGTAGAGCAATCAAGCAGTTGGATTATGAATGGAAGGTTGTAAACCCCTATTATTTGC
GTGTACGAAGGAAGAATCCTGTGACAAGCACATTTTCCAAAATGAGTCTACAGCTATACCAAGTGGATAG
TAGGACTTACTTGTTGGATTTCCGTAGTATTGATGATGAGATTACAGAAGCCAAATCAGGGACTGCTACT
CCACAGAGATCGGGATCCATCAGCAACTATCGATCTTGCCAAAGGAGTGACTCTGATGCCGAAGCTCAAG
GAAAGCCCTCAGACGTCTCCCTTACCTCATCTGTCACCTCCCTCGACTCCTCCCCTGTCGACGTAGCTCC
AAGACCAGGAAGTCATACAATAGAATTTTTTGAAATGTGTGCAAATCTAATTAAAATTCTTGCACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR227383 representing NM_001013367
Red=Cloning site Green=Tags(s)

MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVG
KIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDY
CHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWS
SGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRAAIKDIREHEWFK
QDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKD
FYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTAT
PQRSGSISNYRSCQRSDSDAEAQGKPSDVSLTSSVTSLDSSPVDVAPRPGSHTIEFFEMCANLIKILAQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001013367
ORF Size 1677 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001013367.3, NP_001013385.3
RefSeq Size 4655 bp
RefSeq ORF 1680 bp
Locus ID 105787
UniProt ID Q5EG47
Cytogenetics 15 A1
MW 64.4 kDa
Summary Catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Regulates lipid synthesis by phosphorylating and inactivating lipid metabolic enzymes such as ACACA, ACACB, GYS1, HMGCR and LIPE; regulates fatty acid and cholesterol synthesis by phosphorylating acetyl-CoA carboxylase (ACACA and ACACB) and hormone-sensitive lipase (LIPE) enzymes, respectively. Regulates insulin-signaling and glycolysis by phosphorylating IRS1, PFKFB2 and PFKFB3. AMPK stimulates glucose uptake in muscle by increasing the translocation of the glucose transporter SLC2A4/GLUT4 to the plasma membrane, possibly by mediating phosphorylation of TBC1D4/AS160. Regulates transcription and chromatin structure by phosphorylating transcription regulators involved in energy metabolism such as CRTC2/TORC2, FOXO3, histone H2B, HDAC5, MEF2C, MLXIPL/ChREBP, EP300, HNF4A, p53/TP53, SREBF1, SREBF2 and PPARGC1A. Acts as a key regulator of glucose homeostasis in liver by phosphorylating CRTC2/TORC2, leading to CRTC2/TORC2 sequestration in the cytoplasm. In response to stress, phosphorylates 'Ser-36' of histone H2B (H2BS36ph), leading to promote transcription. Acts as a key regulator of cell growth and proliferation by phosphorylating TSC2, RPTOR and ATG1/ULK1: in response to nutrient limitation, negatively regulates the mTORC1 complex by phosphorylating RPTOR component of the mTORC1 complex and by phosphorylating and activating TSC2. In response to nutrient limitation, promotes autophagy by phosphorylating and activating ATG1/ULK1. In that process also activates WDR45. In response to nutrient limitation, phosphorylates transcription factor FOXO3 promoting FOXO3 mitochondrial import (PubMed:23283301). AMPK also acts as a regulator of circadian rhythm by mediating phosphorylation of CRY1, leading to destabilize it. May regulate the Wnt signaling pathway by phosphorylating CTNNB1, leading to stabilize it. Also has tau-protein kinase activity: in response to amyloid beta A4 protein (APP) exposure, activated by CAMKK2, leading to phosphorylation of MAPT/TAU; however the relevance of such data remains unclear in vivo. Also phosphorylates CFTR, EEF2K, KLC1, NOS3 and SLC12A1.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Prkaa1 (NM_001013367) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC218994 Prkaa1 (untagged) - Mouse protein kinase, AMP-activated, alpha 1 catalytic subunit (Prkaa1), (10ug) 10 ug
$834.00
MG227383 Prkaa1 (tGFP-tagged) - Mouse protein kinase AMP-activated alpha 1 catalytic subunit (Prkaa1), (10ug) 10 ug
$980.00
MR227383L3 Lenti ORF clone of Prkaa1 (Myc-DDK-tagged) - Mouse protein kinase, AMP-activated, alpha 1 catalytic subunit (Prkaa1) 10 ug
$1,080.00
MR227383L4 Lenti ORF clone of Prkaa1 (mGFP-tagged) - Mouse protein kinase, AMP-activated, alpha 1 catalytic subunit (Prkaa1) 10 ug
$1,080.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.